arath-At2g19620

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) NDL3 putative sf21 protein (helianthus annuus)

Comment
Involved in a signaling pathway that modulates root auxin transport and auxin gradients. Acts partially by positively regulating the auxin carrier PIN2 and AUX1. Acts, together with GB1 as positive regulator of meristem initiation and branching. GB1 and NDL3 positively regulate basipetal inflorescence auxin transport and modulate MAX2 expression in shoots, which regulates organ and lateral meristem formation by the establishment and maintenance of auxin gradients. Other strains: Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)


Relationship
Family Ndr_family
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AC005917, NP_179552, NP_001323956
3 UniProt : Q9ZUN1, A8MRP5, D7L6Y2
>3 UniProtTrembl links 2 more: Q9ZUN1, A8MRP5, D7L6Y2
>3 Interpro links 2 more: Q9ZUN1, A8MRP5, D7L6Y2
>3 Prodom links 2 more: Q9ZUN1, A8MRP5, D7L6Y2
>3 Pfam links 2 more: Q9ZUN1, A8MRP5, D7L6Y2
>3 PIRSF links 2 more: Q9ZUN1, A8MRP5, D7L6Y2
>3 SUPERFAM links 2 more: Q9ZUN1, A8MRP5, D7L6Y2
>3 QuickSwissBlast links 2 more: Q9ZUN1, A8MRP5, D7L6Y2
1 Tair database : At2g19620
 
Sequence
Graphical view for this peptide sequence: arath-At2g19620
Colored MSA for Ndr_family (raw)
MVGLNNAVSLDIEEICNGGKEHHVKTCHGSVSVVVYGDQEKPALITYPDV
ALNYMSCFQGLFLCPEAVSLLLHNFCIYHISPPGHEFGAAPVCSNDPSPS
VEDLADQILEVLNFFSLEAVMCMGITAGAYILSLFAIKHKERVLGLILIS
PLCKAPSWSEWFYYKVVSNLLYYYGMSGLLKDIFLQRYFSKEARGSSEVP
ERDVVHECRRLLGERHGSSLMRFLEAVNRRHDLTDGLKSLKCRTLIFVGD
QSPFHSETLHMVTALDRKYSALVEVQACGSMVTEEQPHAMLIPMEFFFMG
FGLYRPGRVSDSPRSPLSPSCISPELLSPESLGLKLKPIKTRVPTKC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVGLNNAVSLDIEEICNGGKEHHVKTCHGSVSVVVYGDQEKPALITYPDV
ALNYMSCFQGLFLCPEAVSLLLHNFCIYHISPPGHEFGAAPVCSNDPSPS
VEDLADQILEVLNFFSLEAVMCMGITAGAYILSLFAIKHKERVLGLILIS
PLCKAPSWSEWFYYKVVSNLLYYYGMSGLLKDIFLQRYFSKEARGSSEVP
ERDVVHECRRLLGERHGSSLMRFLEAVNRRHDLTDGLKSLKCRTLIFVGD
QSPFHSETLHMVTALDRKYSALVEVQACGSMVTEEQPHAMLIPMEFFFMG
FGLYRPGRVSDSPRSPLSPSCISPELLSPESLGLKLKPIKTRVPTKC

no DNA




References
    Title: N-MYC down-regulated-like proteins regulate meristem initiation by modulating auxin transport and MAX2 expression
    Mudgil Y, Ghawana S, Jones AM
    Ref: PLoS ONE, 8:e77863, 2013 : PubMed

            

    Title: Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway
    Mudgil Y, Uhrig JF, Zhou J, Temple B, Jiang K, Jones AM
    Ref: Plant Cell, 21:3591, 2009 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer