arath-F12L6.8

 
Arabidopsis thaliana (Mouse-ear cress) AtMAGL8 putative lysophospholipase

Comment
AtMAGL8 monoacylglycerol lipase, Has MAGL activity, exhibited the highest hydrolase activities with MAG containing 20:1 fatty acids, targeted to the endoplasmic reticulum and/or Golgi network. Kim et al.2016


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: AC004218, NM_129500, AF370602
2 UniProtTrembl : O80629, Q8RXN7
2 Interpro : O80629, Q8RXN7
2 Prodom : O80629, Q8RXN7
2 Pfam : O80629, Q8RXN7
2 PIRSF : O80629, Q8RXN7
2 SUPERFAM : O80629, Q8RXN7
2 QuickSwissBlast : O80629, Q8RXN7
1 Tair database : AT2G39420
 
Sequence
Graphical view for this peptide sequence: arath-F12L6.8
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MQASETENIKYEESFIKNTRGMKLFTCKWVPAKQEPKALVFICHGYAMEC
SITMNSTARRLVKAGFAVYGIDYEGHGKSDGLSAYVPNFDHLVDDVSTHY
TSICEKEENKGKMRFLLGESMGGAVLLLLHRKKPQFWDGAVLVAPMCKIA
EEMKPSPLVISILAKLSGVIPSWKIIPGQDIIETAFKQPEIRKQVRENPY
CYKGRPRLKTAYELLRVSTDLEKRLNEVSLPFIVLHGEDDKVTDKAVSRQ
LYEVASSSDKTFKLYPGMWHGLLYGETPENIETVFADIIGWLDKKVADES
GGFESELKRKNDGIPLKG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQASETENIKYEESFIKNTRGMKLFTCKWVPAKQEPKALVFICHGYAMEC
SITMNSTARRLVKAGFAVYGIDYEGHGKSDGLSAYVPNFDHLVDDVSTHY
TSICEKEENKGKMRFLLGESMGGAVLLLLHRKKPQFWDGAVLVAPMCKIA
EEMKPSPLVISILAKLSGVIPSWKIIPGQDIIETAFKQPEIRKQVRENPY
CYKGRPRLKTAYELLRVSTDLEKRLNEVSLPFIVLHGEDDKVTDKAVSRQ
LYEVASSSDKTFKLYPGMWHGLLYGETPENIETVFADIIGWLDKKVADES
GGFESELKRKNDGIPLKG

no DNA




References
    Title: Molecular and biochemical characterizations of the monoacylglycerol lipase gene family of Arabidopsis thaliana
    Kim RJ, Kim HJ, Shim D, Suh MC
    Ref: Plant J, 85:758, 2016 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer