Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-SOBR1

Arabidopsis thaliana AtSOBER1 AT4G22305 gene, chromosome 4 locus:6530298215

Comment
Conserved Carboxylesterase (SOBER1, Is a SUPPRESSOR OF AVRBST-ELICITED RESISTANCE in Arabidopsis by Cunnac et al.. AL021712 O49635 a repetition of the same sequence in tandem Q8GYK2 Q84WK4 are only the N-term part of O49635. Burger et al. show that Acyl-protein thioesterase structures present a long tunnel for accommodation of long-chain fatty acids and release the product by use of a flexible loop tunnel lid. Homologous deacetylases use a hydrophobic residue to fix the lid and another residue to close the tunnel entrance. This causes loop rigidity changing the catalytic preference to deacetylation. SOBER1 is a protein deacetylase and not an acylprotein thioesterase


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
3 structures: 6AVV, 6AVW, 6AVX
No kinetic





No Substrate
No inhibitor
3 Genbank : AL021712, BT003123, AK117563
2 UniProt : Q84WK4, A0A1P8B7S1
1 Ncbi-nid : 7269078
1 Ncbi-pid : 2832680
3 Structure : 6AVV, 6AVW, 6AVX
>3 UniProt links 1 more: A4KWB0, Q84WK4, O49635
>3 Interpro links 1 more: A4KWB0, Q84WK4, O49635
>3 Prodom links 1 more: A4KWB0, Q84WK4, O49635
>3 Pfam links 1 more: A4KWB0, Q84WK4, O49635
>3 PIRSF links 1 more: A4KWB0, Q84WK4, O49635
>3 SUPERFAM links 1 more: A4KWB0, Q84WK4, O49635
1 Tair database : AT4g22305
Sequence
Graphical view for this peptide sequence: arath-SOBR1
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MARTFILWLHGLGDSGPANEPIQTQFKSSELSNASWLFPSAPFNPVTCNN
GAVMRSWFDVPELPFKVGSPIDESSVLEAVKNVHAIIDQEIAEGTNPENV
FICGLSQGGALTLASVLLYPKTLGGGAVLSGWVPFTSSIISQFPEEAKKT
PILWSHGTDDRMVLFEAGQAALPFLKEAGVTCEFKAYPGLGHSISNKELK
YIESWIKRRLKGSSSTCLQLNCLKEMFH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARTFILWLHGLGDSGPANEPIQTQFKSSELSNASWLFPSAPFNPVTCNN
GAVMRSWFDVPELPFKVGSPIDESSVLEAVKNVHAIIDQEIAEGTNPENV
FICGLSQGGALTLASVLLYPKTLGGGAVLSGWVPFTSSIISQFPEEAKKT
PILWSHGTDDRMVLFEAGQAALPFLKEAGVTCEFKAYPGLGHSISNKELK
YIESWIKRRLKGSSSTCLQLNCLKEMFH


References
    Title: A hydrophobic anchor mechanism defines a deacetylase family that suppresses host response against YopJ effectors
    Burger M, Willige BC, Chory J
    Ref: Nat Commun, 8:2201, 2017 : PubMed

            

    Title: A conserved carboxylesterase is a SUPPRESSOR OF AVRBST-ELICITED RESISTANCE in Arabidopsis
    Cunnac S, Wilson A, Nuwer J, Kirik A, Baranage G, Mudgett MB
    Ref: Plant Cell, 19:688, 2007 : PubMed

            

    Title: Analysis of 1.9 Mb of contiguous sequence from chromosome 4 of Arabidopsis thaliana.
    Bevan M, Bancroft I, Bent E, Love K, Goodman H, Dean C, Bergkamp R, Dirkse W, van Staveren M and Chalwatzis N <58 more author(s)>
    Ref: Nature, 391:485, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer