Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-BC4116

Bacillus cereus, Bacillus thuringiensis, bioh protein

Comment
Other strains: Bacillus cereus (strains ATCC 14579 / DSM 31; ZK; G9241; F65185; AH1134; Rock4-2; Rock1-15; 172560W; ATCC 10876; G9842; AH676; BDRD-ST24; m1550; BDRD-Cer4; B4264) Bacillus thuringiensis (strains serovars israelensis ATCC 35646; berliner ATCC 10792; thuringiensis T01001; sotto T04001; pakistani T13001; uazhongensis BGSC 4BD1; kurstaki T03a001; Bt407; IBL 4222; IBL 200 )


Relationship
Family|BioH
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 22 more: CP000001, AE017011, AAEK01000025
>3 UniProt links 10 more: Q635G5, Q3EYJ5, C2XGC8
>3 UniProt links 11 more: Q818X1, Q635G5, Q3EYJ5
>3 Interpro links 11 more: Q818X1, Q635G5, Q3EYJ5
>3 Pfam links 11 more: Q818X1, Q635G5, Q3EYJ5
>3 PIRSF links 11 more: Q818X1, Q635G5, Q3EYJ5
>3 SUPERFAM links 11 more: Q818X1, Q635G5, Q3EYJ5
Sequence
Graphical view for this peptide sequence: bacce-BC4116
Colored MSA for BioH (raw)
MNELKIIFIPGWGMEENIWDLVLPYFKGYSVQCIDWRNVKERSEFAERII
DVAHNDNVILVGWSLGALAAVEAYKKIQAKGIVLIGGTAKFTNTSDYSNG
WNALHVERLKRNLARRKEDTLKRFYENMFTKDELKENKNFEDIVDRFKGD
SIQSLQLGLDYLIETDMREELKEIKVPILLIHGEQDVICPLSAARSMTEN
SSSELKVVSEAGHALCVMNFEYCANEIIQFVEGIRHDQQNVTTKTV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNELKIIFIPGWGMEENIWDLVLPYFKGYSVQCIDWRNVKERSEFAERII
DVAHNDNVILVGWSLGALAAVEAYKKIQAKGIVLIGGTAKFTNTSDYSNG
WNALHVERLKRNLARRKEDTLKRFYENMFTKDELKENKNFEDIVDRFKGD
SIQSLQLGLDYLIETDMREELKEIKVPILLIHGEQDVICPLSAARSMTEN
SSSELKVVSEAGHALCVMNFEYCANEIIQFVEGIRHDQQNVTTKTV


References
    Title: Identification of anthrax toxin genes in a Bacillus cereus associated with an illness resembling inhalation anthrax
    Hoffmaster AR, Ravel J, Rasko DA, Chapman GD, Chute MD, Marston CK, De BK, Sacchi CT, Fitzgerald C and Fraser CM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:8449, 2004 : PubMed

            

    Title: Genome sequence of Bacillus cereus and comparative analysis with Bacillus anthracis.
    Ivanova N, Sorokin A, Anderson I, Galleron N, Candelon B, Kapatral V, Bhattacharyya A, Reznik G, Mikhailova N and Kyrpides N <13 more author(s)>
    Ref: Nature, 423:87, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer