Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brume-dhE2

Brucella abortus, Brucella melitensis, Brucella suis, B. canis, B. neotomae, B. sp., B. ceti, B. pinnipedialis, putative dhE2

Comment
Putative TPP-dependent Branched-chain alpha-keto acid dehydrogenase subunit E2 (EC 2.3.1.12), Dihydrolipoamide acetyltransferase, Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system Other strains: Brucella abortus (strains 2308; bv. 3 str. Tulya; S19; bv. 4 str. 292; bv. 9 str. C68; str. 2308 A; bv. 6 str. 870; bv. 2 str. 86/8/59; NCTC 8038), Brucella melitensis (biotype 2 (strain ATCC 23457); bv. 2 str. 63/9; bv. 1 str. 16M; bv. 1 str. Rev.1; bv. 3 str.), Brucella suis (bv. 4 str. 40; bv. 3 str. 686; ATCC 23445 / NCTC 10510; bv. 5 str. 513), Brucella canis (strain ATCC 23365 / NCTC 10854), Brucella neotomae 5K33, Brucella sp. F5/99, Brucella ceti (strains Cudo; M13/05/1; M644/93/1; B1/94; M490/95/1),Brucella pinnipedialis (M292/94/1; M163/99/10; B2/94) only c-term PfamA Abhydrolase_1 214 421


Relationship
Family|AcoC_BiotinLipoyl-ABH
Block| X
Position in NCBI Life Tree|Brucella abortus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella abortus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: brume-dhE2
Colored MSA for AcoC_BiotinLipoyl-ABH (raw)
ARPEGDCLLNAVWLRKGEGTPLVLLHGFASDHNNWRGLFAGTQWQQPLLA
IDLPSHGASPLVAVTSLDAIAAMIEATLKALDIQRAILVGHSFGAAVSAR
LANRGNIDIRALGLFSPAGLGPEINVGFVQNFVRARARESVTPWLHELVH
DKASISDTFIKAVVQQRQDNDLSDAMMAFSEHFFADGTQTVSILDDLASL
EIPVRVIYGRQDRILPFRYTRNLPDNVALYAFDACGHMPHLEKRGLSLRI
LAEVSASAAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ARPEGDCLLNAVWLRKGEGTPLVLLHGFASDHNNWRGLFAGTQWQQPLLA
IDLPSHGASPLVAVTSLDAIAAMIEATLKALDIQRAILVGHSFGAAVSAR
LANRGNIDIRALGLFSPAGLGPEINVGFVQNFVRARARESVTPWLHELVH
DKASISDTFIKAVVQQRQDNDLSDAMMAFSEHFFADGTQTVSILDDLASL
EIPVRVIYGRQDRILPFRYTRNLPDNVALYAFDACGHMPHLEKRGLSLRI
LAEVSASAAG


References
1 more
    Title: Whole-genome analyses of speciation events in pathogenic Brucellae
    Chain PS, Comerci DJ, Tolmasky ME, Larimer FW, Malfatti SA, Vergez LM, Aguero F, Land ML, Ugalde RA, Garcia E
    Ref: Infect Immun, 73:8353, 2005 : PubMed

            

    Title: Completion of the genome sequence of Brucella abortus and comparison to the highly similar genomes of Brucella melitensis and Brucella suis
    Halling SM, Peterson-Burch BD, Bricker BJ, Zuerner RL, Qing Z, Li LL, Kapur V, Alt DP, Olsen SC
    Ref: Journal of Bacteriology, 187:2715, 2005 : PubMed

            

    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer