Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: desps-q6ajw5

Desulfotalea psychrophila related to haloalkane dehalogenase HLDIII DdpA

Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|Desulfotalea psychrophila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > Desulfobacterales: N E > Desulfobulbaceae: N E > Desulfotalea: N E > Desulfotalea psychrophila: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CR522870, WP_011189873
1 UniProt : Q6AJW5
1 UniProt : Q6AJW5
1 Interpro : Q6AJW5
1 Pfam : Q6AJW5
1 PIRSF : Q6AJW5
1 SUPERFAM : Q6AJW5
Sequence
Graphical view for this peptide sequence: desps-q6ajw5
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MFTEYPFQSNYFEIGGQRLHYVDEGHGPVIVLVHGNPTWSFYYRRVISLL
SKTHRIIAVDHMGCGLSDKPQDYSYTLQTHRQNLFQLLEHLQIEKYSLVV
HDWGGAIGVGCAAFAPERVEKLVVLNTAAFRSTHIPLRISLCRAPLFGEY
LVRGLNGFAWPASFMAVQKRLSKEVVAGYLAPYSNWEKRVAVYGFVHDIP
LNSAHPSYGTLVEVERGLEALVARQVPTLILWGGKDFCFNDHFYRQWCER
VPYAEKVYYENGGHYILEDEFADIAPRLERFFTVCEED
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFTEYPFQSNYFEIGGQRLHYVDEGHGPVIVLVHGNPTWSFYYRRVISLL
SKTHRIIAVDHMGCGLSDKPQDYSYTLQTHRQNLFQLLEHLQIEKYSLVV
HDWGGAIGVGCAAFAPERVEKLVVLNTAAFRSTHIPLRISLCRAPLFGEY
LVRGLNGFAWPASFMAVQKRLSKEVVAGYLAPYSNWEKRVAVYGFVHDIP
LNSAHPSYGTLVEVERGLEALVARQVPTLILWGGKDFCFNDHFYRQWCER
VPYAEKVYYENGGHYILEDEFADIAPRLERFFTVCEED


References
    Title: Functional and Mechanistic Characterization of an Enzyme Family Combining Bioinformatics and High-Throughput Microfluidics
    Vasina M, Vanacek P, Hon J, Kovar D, Faldynova H, Kunka A, Badenhorst C, Buryska T, Mazurenko S and Prokop Z <5 more author(s)>
    Ref: ResearchSquare, :, 2021 : PubMed

            

    Title: The genome of Desulfotalea psychrophila, a sulfate-reducing bacterium from permanently cold Arctic sediments
    Rabus R, Ruepp A, Frickey T, Rattei T, Fartmann B, Stark M, Bauer M, Zibat A, Lombardot T and Klenk HP <8 more author(s)>
    Ref: Environ Microbiol, 6:887, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer