Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: luccu-E3aest7

Lucilia cuprina (and Lucilia sericata (Green bottle fly) (Phaenicia sericata)) alpha cluster carboxylesterase (OP resistance (LcaE7) E3

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Lucilia cuprina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Calyptratae: N E > Oestroidea: N E > Calliphoridae: N E > Luciliinae: N E > Lucilia: N E > Lucilia cuprina: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
18 mutations: Table (e.g. : E217M, F309L, F354L ... more)
29 structures (e.g. : 4FNG, 4FNM, 4QWM... more)
No kinetic





No Substrate
7 inhibitors (e.g. : (3-(Benzyloxy)-4-methylphenyl)boronic-acid, (3-bromo-4-methylphenyl)boronic-acid, (3-bromo-5-phenoxyphenyl)boronic-acid... more)
Sequence
Graphical view for this peptide sequence: luccu-E3aest7
Colored MSA for Carb_B_Arthropoda (raw)
MNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTV
YDDSYYSFEGIPYAQPPVGELRFKAPQRPTPWDGVRDCCNHKDKSVQVDF
ITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGP
DYFIKKDVVLINIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKN
NCANFGGNPDNITVFGESAGAASTHYMMLTEQTRGLFHRGILMSGNAICP
WANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTL
EERTNKVMFPFGPTVEPYQTADCVLPKHPREMVKTAWGNSIPTMMGNTSY
EGLFFTSILKQMPMLVKELETCVNFVPSELADAERTAPETLEMGAKIKKA
HVTGETPTADNFMDLCSHIYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDS
EDLINPYRIMRSGRGVKGVSHADELTYFFWNQLAKRMPKESREYKTIERM
TGIWIQFATTGNPYSNEIEGMENVSWDPIKKSDEVYKCLNISDELKMIDV
PEMDKIKQWESMFEKHRDLF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTV
YDDSYYSFEGIPYAQPPVGELRFKAPQRPTPWDGVRDCCNHKDKSVQVDF
ITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGP
DYFIKKDVVLINIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKN
NCANFGGNPDNITVFGESAGAASTHYMMLTEQTRGLFHRGILMSGNAICP
WANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTL
EERTNKVMFPFGPTVEPYQTADCVLPKHPREMVKTAWGNSIPTMMGNTSY
EGLFFTSILKQMPMLVKELETCVNFVPSELADAERTAPETLEMGAKIKKA
HVTGETPTADNFMDLCSHIYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDS
EDLINPYRIMRSGRGVKGVSHADELTYFFWNQLAKRMPKESREYKTIERM
TGIWIQFATTGNPYSNEIEGMENVSWDPIKKSDEVYKCLNISDELKMIDV
PEMDKIKQWESMFEKHRDLF


References
11 more
    Title: Overcoming insecticide resistance through computational inhibitor design
    Correy GJ, Zaidman D, Harmelin A, Carvalho S, Mabbitt PD, Calaora V, James PJ, Kotze AC, Jackson CJ, London N
    Ref: Proc Natl Acad Sci U S A, 116:21012, 2019 : PubMed

            

    Title: Mapping the Accessible Conformational Landscape of an Insect Carboxylesterase Using Conformational Ensemble Analysis and Kinetic Crystallography
    Correy GJ, Carr PD, Meirelles T, Mabbitt PD, Fraser NJ, Weik M, Jackson CJ
    Ref: Structure, 24:977, 2016 : PubMed

            

    Title: Evolution of Protein Quaternary Structure in Response to Selective Pressure for Increased Thermostability
    Fraser NJ, Liu JW, Mabbitt PD, Correy GJ, Coppin CW, Lethier M, Perugini MA, Murphy JM, Oakeshott JG and Jackson CJ <1 more author(s)>
    Ref: Journal of Molecular Biology, 428:2359, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer