Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nasvi-ACHE1

Nasonia vitripennis similar to ace1 type

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Nasonia vitripennis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Hymenoptera: N E > Apocrita: N E > Terebrantes: N E > Chaldicoidea group: N E > Chalcidoidea: N E > Pteromalidae: N E > Pteromalinae: N E > Nasonia: N E > Nasonia vitripennis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : XM_001600408
1 UniProt : A0A7M7LV41
1 Ncbi-nid : 156546049
1 Ncbi-pid : 156546050
1 UniProt : A0A7M7LV41
1 Interpro : A0A7M7LV41
1 Prodom : A0A7M7LV41
1 Pfam : A0A7M7LV41
1 PIRSF : A0A7M7LV41
1 SUPERFAM : A0A7M7LV41
Sequence
Graphical view for this peptide sequence: nasvi-ACHE1
Colored MSA for ACHE (raw)
MTAGSSFILSSIILLLSSTLLLLPLPTKKGRVKGATLTATTGKKVDAWFG
IPYAQKPLGPLRFRHPRPAEAWEGVLNATSPPNSCVQILDTVFGDFSGAM
MWNPNTPLSEDCLYVNVVAPKPRPTNAAVMVWIFGGGFYSGTATLDVYDH
RTIVSEENIILVSMQYRVASLGFLYFGTSDVPGNAGLFDQMMALQWVRDN
IAAFGGNPDNVTLFGESAGAVSVSMLLLSPLSRHLFNQAIMQSGSATAPW
AIITREESIMRGLRLAEAVGCPHDKSDLRAVIDCLISQEAEVLVNSEWGT
LGICEFPFVPVIDGAFLDETPQRSMLTESFKKANILMGSNTEEGFYFIIY
YLTELFRIDGTEDVKVPRDEFVRAVSELNPYVNPIGRYAIIYEYTDWLRP
DDPDANRNALDKIVGDYHFTCNVNEFASRYAETGNKVYMYYYTHRSANNP
WPRWTGVMHADEISYIFGEPLDPTKGYTQEEKHLSKRMMRYWANFAKTGD
PNMGDDGSSWTEVTWPVHTATKKEYLTLDTNTTEIGYGPRVRQCAFWKKY
LPQLLAATSKLDQSKETCSGAAAPALDSRGACLLLMSLVTIGLRALSGAS
QLWPQPRGPV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAGSSFILSSIILLLSSTLLLLPLPTKKGRVKGATLTATTGKKVDAWFG
IPYAQKPLGPLRFRHPRPAEAWEGVLNATSPPNSCVQILDTVFGDFSGAM
MWNPNTPLSEDCLYVNVVAPKPRPTNAAVMVWIFGGGFYSGTATLDVYDH
RTIVSEENIILVSMQYRVASLGFLYFGTSDVPGNAGLFDQMMALQWVRDN
IAAFGGNPDNVTLFGESAGAVSVSMLLLSPLSRHLFNQAIMQSGSATAPW
AIITREESIMRGLRLAEAVGCPHDKSDLRAVIDCLISQEAEVLVNSEWGT
LGICEFPFVPVIDGAFLDETPQRSMLTESFKKANILMGSNTEEGFYFIIY
YLTELFRIDGTEDVKVPRDEFVRAVSELNPYVNPIGRYAIIYEYTDWLRP
DDPDANRNALDKIVGDYHFTCNVNEFASRYAETGNKVYMYYYTHRSANNP
WPRWTGVMHADEISYIFGEPLDPTKGYTQEEKHLSKRMMRYWANFAKTGD
PNMGDDGSSWTEVTWPVHTATKKEYLTLDTNTTEIGYGPRVRQCAFWKKY
LPQLLAATSKLDQSKETCSGAAAPALDSRGACLLLMSLVTIGLRALSGAS
QLWPQPRGPV


Reference
    Title: Functional and evolutionary insights from the genomes of three parasitoid Nasonia species
    Werren JH, Richards S, Desjardins CA, Niehuis O, Gadau J, Colbourne JK, Beukeboom LW, Desplan C, Elsik CG and Williamson M <147 more author(s)>
    Ref: Science, 327:343, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer