Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nemve-a7sgb1

Nematostella vectensis (Starlet sea anemone) Predicted protein

Relationship
Family|Maspardin-ACP33-SPG21_like
Block| X
Position in NCBI Life Tree|Nematostella vectensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Cnidaria: N E > Anthozoa: N E > Hexacorallia: N E > Actiniaria: N E > Edwardsiidae: N E > Nematostella: N E > Nematostella vectensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DS469651
1 UniProt : A7SGB1
1 UniProt : A7SGB1
1 Interpro : A7SGB1
1 Pfam : A7SGB1
1 PIRSF : A7SGB1
1 SUPERFAM : A7SGB1
Sequence
Graphical view for this peptide sequence: nemve-a7sgb1
Colored MSA for Maspardin-ACP33-SPG21_like (raw)
MTDFTAISRSQEYLSFRSTVPHRRVVVDSSGEKEWALYDAGPRSVRCPLI
CLPPASGTADVFFKQILTLSSLGYRVISVEYPVYWTYSEWTDGFRKLLDF
LHLDKVHLFGASLGGFLAQKFCEMTCKSPRVHSIILCNAFSDTSVFQQTA
TSSAFWMMPAFVLKKMIMNNFNTDIVDADIADSIDFMVERLESMGRNELA
SRLTLNCVDSYVEPQKLHDVPITIIDVFDDCALSQPVKDELYKCYPDAKR
AHLKSGGNFPYLCRSADVNLYLQIHLRQFLGTRYSAIDSKYLTEEDLEAC
NLVSTPSTLTSPANL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDFTAISRSQEYLSFRSTVPHRRVVVDSSGEKEWALYDAGPRSVRCPLI
CLPPASGTADVFFKQILTLSSLGYRVISVEYPVYWTYSEWTDGFRKLLDF
LHLDKVHLFGASLGGFLAQKFCEMTCKSPRVHSIILCNAFSDTSVFQQTA
TSSAFWMMPAFVLKKMIMNNFNTDIVDADIADSIDFMVERLESMGRNELA
SRLTLNCVDSYVEPQKLHDVPITIIDVFDDCALSQPVKDELYKCYPDAKR
AHLKSGGNFPYLCRSADVNLYLQIHLRQFLGTRYSAIDSKYLTEEDLEAC
NLVSTPSTLTSPANL


Reference
    Title: Sea anemone genome reveals ancestral eumetazoan gene repertoire and genomic organization
    Putnam NH, Srivastava M, Hellsten U, Dirks B, Chapman J, Salamov A, Terry A, Shapiro H, Lindquist E and Rokhsar DS <9 more author(s)>
    Ref: Science, 317:86, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer