Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: poptr-b9gga9

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa). AB hydrolase-1 domain-containing protein

Relationship
Family|TGL-GrainShapeFactor
Block| X
Position in NCBI Life Tree|Populus trichocarpa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Malpighiales: N E > Salicaceae: N E > Saliceae: N E > Populus: N E > Populus trichocarpa: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CM009290
1 UniProt : B9GGA9
1 UniProt : B9GGA9
1 Interpro : B9GGA9
1 Pfam : B9GGA9
1 PIRSF : B9GGA9
1 SUPERFAM : B9GGA9
Sequence
Graphical view for this peptide sequence: poptr-b9gga9
Colored MSA for TGL-GrainShapeFactor (raw)
MMSKCFSFTASRDWFYRYSFAKAGLRAHSANLGDGTIMHCWVPRIIKSSK
PSLLLLHGFGANAMWQYGQHLHIFTSRFNVYVPDLLFFGESYTSRPERTE
SFQAQCVMRLMEAHGVHRMNLVGISYGGFVGYSMAAQFQEKIEKVVLCCA
GVCLEEKDMDNGLFAVPNLDEAASILLPQTAEKLRELMRFSFVKPAIGIP
SFFLTDFIDVMCTDYVKEKRELIQAILHGRNLSVLPKITQPTLIIWGEKD
QIFPVELGHRLKRHVGESSQLVIVKNAGHAVNLEKAKEFAKHLKSFLIDS
AASPSPSPGSLTDFIHDKNEG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMSKCFSFTASRDWFYRYSFAKAGLRAHSANLGDGTIMHCWVPRIIKSSK
PSLLLLHGFGANAMWQYGQHLHIFTSRFNVYVPDLLFFGESYTSRPERTE
SFQAQCVMRLMEAHGVHRMNLVGISYGGFVGYSMAAQFQEKIEKVVLCCA
GVCLEEKDMDNGLFAVPNLDEAASILLPQTAEKLRELMRFSFVKPAIGIP
SFFLTDFIDVMCTDYVKEKRELIQAILHGRNLSVLPKITQPTLIIWGEKD
QIFPVELGHRLKRHVGESSQLVIVKNAGHAVNLEKAKEFAKHLKSFLIDS
AASPSPSPGSLTDFIHDKNEG


Reference
    Title: The genome of black cottonwood, Populus trichocarpa (Torr. & Gray)
    Tuskan GA, Difazio S, Jansson S, Bohlmann J, Grigoriev I, Hellsten U, Putnam N, Ralph S, Rombauts S and Rokhsar D <100 more author(s)>
    Ref: Science, 313:1596, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer