Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesy-PSPTO4540

Pseudomonas syringae (pv. tomato; pv. actinidiae; pv. morsprunorum ) proline iminopeptidase, putative

Comment
Other strains: Pseudomonas syringae (pv. tomato T1; pv. actinidiae (ICMP 19098; ICMP 19100; ICMP 18804; ICMP 19096; ICMP 18883; ICMP 19099; ICMP 19095; ICMP 19094; ICMP 18807); pv. lachrymans str. M302278; pv. morsprunorum str. M302280)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Pseudomonas syringae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas syringae group: N E > Pseudomonas syringae group genomosp. 1: N E > Pseudomonas syringae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
7A6G: Structure of L-proline amide hydrolase from Pseudomonas syringae
No kinetic





3 substrates: (S)-piperazine-2-carboxamide, L-prolinamide, Piperazine-2-tert-butylcarboxamide
No inhibitor
>3 Genbank links 15 more: AE016872, AB237163, KPY90469
>3 UniProt links 2 more: Q0EE62, Q87WK6, A0A0Q0CYJ4
1 Structure : 7A6G
>3 UniProt links 17 more: Q87WK6, Q0EE62, A0A0Q0CYJ4
>3 Interpro links 17 more: Q87WK6, Q0EE62, A0A0Q0CYJ4
>3 Prodom links 17 more: Q87WK6, Q0EE62, A0A0Q0CYJ4
>3 Pfam links 17 more: Q87WK6, Q0EE62, A0A0Q0CYJ4
>3 PIRSF links 17 more: Q87WK6, Q0EE62, A0A0Q0CYJ4
>3 SUPERFAM links 17 more: Q87WK6, Q0EE62, A0A0Q0CYJ4
Sequence
Graphical view for this peptide sequence: psesy-PSPTO4540
Colored MSA for Proline_iminopeptidase (raw)
MADMADMTIKEGFAPFGDYQTWYRITGDLRGGGTPLVILHGGPGCTHDYV
DSFKDIANTGRAVIHYDQLGNGKSTHLPDMGSEFWTVDLFLSELDNLLEY
LEIADDYALLGQSWGGMLASEHAVLQPTGLQALIIANSPADMHTWVSEAN
RLREELPDDVQATLLKHEEAGTLTDPAYLTASRVFYDRHVCRITPWPVEV
ERTFHQIDEDPTVYRAMNGPTEFHVIGTMKDWSIVDRLSNINVPTLVISG
FYDEATPLVIQPYVDNIPDVRQSVFQESSHMPHVEERMACMGRVADFLDE
VATSGKALPGVKARFG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADMADMTIKEGFAPFGDYQTWYRITGDLRGGGTPLVILHGGPGCTHDYV
DSFKDIANTGRAVIHYDQLGNGKSTHLPDMGSEFWTVDLFLSELDNLLEY
LEIADDYALLGQSWGGMLASEHAVLQPTGLQALIIANSPADMHTWVSEAN
RLREELPDDVQATLLKHEEAGTLTDPAYLTASRVFYDRHVCRITPWPVEV
ERTFHQIDEDPTVYRAMNGPTEFHVIGTMKDWSIVDRLSNINVPTLVISG
FYDEATPLVIQPYVDNIPDVRQSVFQESSHMPHVEERMACMGRVADFLDE
VATSGKALPGVKARFG


References
6 more
    Title: Comparative analysis of argK-tox clusters and their flanking regions in phaseolotoxin-producing Pseudomonas syringae pathovars
    Genka H, Baba T, Tsuda M, Kanaya S, Mori H, Yoshida T, Noguchi MT, Tsuchiya K, Sawada H
    Ref: Journal of Molecular Evolution, 63:401, 2006 : PubMed

            

    Title: The complete genome sequence of the Arabidopsis and tomato pathogen Pseudomonas syringae pv. tomato DC3000
    Buell CR, Joardar V, Lindeberg M, Selengut J, Paulsen IT, Gwinn ML, Dodson RJ, DeBoy RT, Durkin AS and Collmer A <34 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:10181, 2003 : PubMed

            

    Title: Comparative analysis of Pseudomonas syringae pv. actinidiae and pv. phaseolicola based on phaseolotoxin-resistant ornithine carbamoyltransferase gene (argK) and 16S-23S rRNA intergenic spacer sequences
    Sawada H, Takeuchi T, Matsuda I
    Ref: Applied Environmental Microbiology, 63:282, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer