Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: salty-P74847

Salmonella typhimurium, Salmonella paratyphi, S. choleraesuis, S. enterica, S. schwarzengrund, S. gallinarum, S. enteritidis, proline iminopeptidase like protein

Comment
The sequence of Salmonella typhimurium P74847 is different in c-term in comparison with S enterica. In ESTHER S enterica V0LJ29 sequence. There are more than 3000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Salmonella typhimurium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Salmonella: N E > Salmonella enterica: N E > Salmonella enterica subsp. enterica: N E > Salmonella enterica subsp. enterica serovar Typhimurium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 11 more: CP000026, AE008760, X99945
3 UniProt : Q57PQ4, C0Q600, B5RAS7
>3 UniProt links 2 more: P74847, Q8ZPP7, Q57PQ4
>3 Interpro links 2 more: P74847, Q8ZPP7, Q57PQ4
>3 Prodom links 2 more: P74847, Q8ZPP7, Q57PQ4
>3 Pfam links 2 more: P74847, Q8ZPP7, Q57PQ4
>3 PIRSF links 2 more: P74847, Q8ZPP7, Q57PQ4
>3 SUPERFAM links 2 more: P74847, Q8ZPP7, Q57PQ4
Sequence
Graphical view for this peptide sequence: salty-P74847
Colored MSA for Proline_iminopeptidase (raw)
MNDTYLYGEMFSENILTSYRIYGDRKSLLTPLIILHGGPSGGFDYLLNYR
RLADDGRMVIFYDQYGCGRSTHFPHADASFWTIARYLRQLTQLIHHLGIG
HGYSILGHSWGGMLAAEHACLQPAGLRGTILASSPASIALWQQEAIRLFN
ALTPMSDDDIKNVIMPAVIYQNPPEQLVAYYARHVYTLAEEAVHVQRSNA
QFAADPTGYHILWGTNELAANGKLADWDITPHLCQIRCPVLVLRGENDQA
TERVVSPLLSHISDCRAVTIPGSSHNPHEENIAPCLAAVSAFLRDLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNDTYLYGEMFSENILTSYRIYGDRKSLLTPLIILHGGPSGGFDYLLNYR
RLADDGRMVIFYDQYGCGRSTHFPHADASFWTIARYLRQLTQLIHHLGIG
HGYSILGHSWGGMLAAEHACLQPAGLRGTILASSPASIALWQQEAIRLFN
ALTPMSDDDIKNVIMPAVIYQNPPEQLVAYYARHVYTLAEEAVHVQRSNA
QFAADPTGYHILWGTNELAANGKLADWDITPHLCQIRCPVLVLRGENDQA
TERVVSPLLSHISDCRAVTIPGSSHNPHEENIAPCLAAVSAFLRDLA


References
5 more
    Title: Comparison of genome degradation in Paratyphi A and Typhi, human-restricted serovars of Salmonella enterica that cause typhoid
    McClelland M, Sanderson KE, Clifton SW, Latreille P, Porwollik S, Sabo A, Meyer R, Bieri T, Ozersky P and Wilson RK <25 more author(s)>
    Ref: Nat Genet, 36:1268, 2004 : PubMed

            

    Title: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2
    McClelland M, Sanderson KE, Spieth J, Clifton SW, Latreille P, Courtney L, Porwollik S, Ali J, Dante M and Wilson RK <16 more author(s)>
    Ref: Nature, 413:852, 2001 : PubMed

            

    Title: Analysis of the boundaries of Salmonella pathogenicity island 2 and the corresponding chromosomal region of Escherichia coli K-12
    Hensel M, Shea JE, Baumler AJ, Gleeson C, Blattner F, Holden DW
    Ref: Journal of Bacteriology, 179:1105, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer