Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thepd-a1s004

Thermofilum pendens (strain Hrk 5) Alpha/beta hydrolase fold

Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Thermofilum pendens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Crenarchaeota: N E > Thermoprotei: N E > Thermoproteales: N E > Thermofilaceae: N E > Thermofilum: N E > Thermofilum pendens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000505
1 UniProt : A1S004
1 UniProt : A1S004
1 Interpro : A1S004
1 Pfam : A1S004
1 PIRSF : A1S004
1 SUPERFAM : A1S004
Sequence
Graphical view for this peptide sequence: thepd-a1s004
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MSAVTREVNLPSGLSTVMRAWLPEGEPKAVVVGIHGFAEHSGRYAHVGDF
LSSRGYALYMYDLRGHGLSKWERGYVDSFDQFVEDSVAFYRLVVSGHAGK
KGFVLGHSMGGVIAVLTVYRLGGEVSGLVTSGAALEVNVGAGTRLLLRLL
SAVNPRGRAKLPVNVDCLSRDKAVAESYVADNLVFKDPTYRLLAEFGRGV
SEAWKAAAKVTVPALLMHGEEDCLVPPSASRKLFQVLPSSDKTLEVFPGM
KHEIFNEVDKEKVLEKLAEWLDKHS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSAVTREVNLPSGLSTVMRAWLPEGEPKAVVVGIHGFAEHSGRYAHVGDF
LSSRGYALYMYDLRGHGLSKWERGYVDSFDQFVEDSVAFYRLVVSGHAGK
KGFVLGHSMGGVIAVLTVYRLGGEVSGLVTSGAALEVNVGAGTRLLLRLL
SAVNPRGRAKLPVNVDCLSRDKAVAESYVADNLVFKDPTYRLLAEFGRGV
SEAWKAAAKVTVPALLMHGEEDCLVPPSASRKLFQVLPSSDKTLEVFPGM
KHEIFNEVDKEKVLEKLAEWLDKHS


Reference
    Title: Genome sequence of Thermofilum pendens reveals an exceptional loss of biosynthetic pathways without genome reduction
    Anderson I, Rodriguez J, Susanti D, Porat I, Reich C, Ulrich LE, Elkins JG, Mavromatis K, Lykidis A and Kyrpides N <13 more author(s)>
    Ref: Journal of Bacteriology, 190:2957, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer