Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vitvi-d7tef1

Vitis vinifera (Grape) Lipase

Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Vitis vinifera
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > rosids incertae sedis: N E > Vitales: N E > Vitaceae: N E > Vitis: N E > Vitis vinifera: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FN595765
1 UniProt : D7TEF1
1 UniProt : D7TEF1
1 Interpro : D7TEF1
1 Pfam : D7TEF1
1 PIRSF : D7TEF1
1 SUPERFAM : D7TEF1
Sequence
Graphical view for this peptide sequence: vitvi-d7tef1
Colored MSA for Acidic_Lipase (raw)
MANALTSIILVILFCRSAAGLRTRLFSNKDWVLDADEGICKLMVETQGYA
CEEHKVTTQDGYILSVQRIPVGRSGEASAERAPVLLQHGLLMDGITWLLL
PPDQSLAFMLADSGFDVWIANTRGTKYSRGHTSLDPGDSAFWDWSWDELV
SYDLPASFQYVHDQTGQKLHYVGHSLGTLIALAAFSQNQLLSMSRSAVLL
SPIAYVGQMTSPLARNAADNFIAESLYWLGLDEFDPRGDAVVNLLKAICK
KPGVDCTDLLTSFTGQNCCLNSSIVDVFLEHEPQSTATKNTIHLSQMIRE
GTLTMYDYEDEDENMEHYGQPTPPVYNMTTIPNDLPLFLSYGGQDALSDV
NDVQLLLESLKDHDGDKLVVQYREDYAHADYVMASNAKRAVYDPLIAFFK
LQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANALTSIILVILFCRSAAGLRTRLFSNKDWVLDADEGICKLMVETQGYA
CEEHKVTTQDGYILSVQRIPVGRSGEASAERAPVLLQHGLLMDGITWLLL
PPDQSLAFMLADSGFDVWIANTRGTKYSRGHTSLDPGDSAFWDWSWDELV
SYDLPASFQYVHDQTGQKLHYVGHSLGTLIALAAFSQNQLLSMSRSAVLL
SPIAYVGQMTSPLARNAADNFIAESLYWLGLDEFDPRGDAVVNLLKAICK
KPGVDCTDLLTSFTGQNCCLNSSIVDVFLEHEPQSTATKNTIHLSQMIRE
GTLTMYDYEDEDENMEHYGQPTPPVYNMTTIPNDLPLFLSYGGQDALSDV
NDVQLLLESLKDHDGDKLVVQYREDYAHADYVMASNAKRAVYDPLIAFFK
LQ


Reference
    Title: The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla
    Jaillon O, Aury JM, Noel B, Policriti A, Clepet C, Casagrande A, Choisne N, Aubourg S, Vitulo N and Wincker P <46 more author(s)>
    Ref: Nature, 449:463, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer