Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: volca-d8u6e0

Volvox carteri f. nagariensis. Peptidase_S9 domain-containing protein

Relationship
Family|Glutamyl_Peptidase_S9
Block| X
Position in NCBI Life Tree|Volvox carteri f. nagariensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Chlorophyta: N E > Chlorophyceae: N E > Chlamydomonadales: N E > Volvocaceae: N E > Volvox: N E > Volvox carteri: N E > Volvox carteri f. nagariensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : GL378362, XP_002954276
1 UniProt : D8U6E0
1 UniProt : D8U6E0
1 Interpro : D8U6E0
1 Pfam : D8U6E0
1 PIRSF : D8U6E0
1 SUPERFAM : D8U6E0
Sequence
Graphical view for this peptide sequence: volca-d8u6e0
Colored MSA for Glutamyl_Peptidase_S9 (raw)
MKQCGRRMIATWKEGSVFKQVLCHVGLSLGPYDLGVLARCPSRDMQSHSS
QPRTMARNSEVFTFAASSPDSWLSGSSPNGYKLPPPEIATIVDAPAQPSL
SYSPDRKTFLQLTRPPSLPPILEMSRPELKLAGLRVDPDLYARSKMSYYT
GISIVPATEVVPAPADKCRTLTGFPAGSWINYVSWSPDGTHIAFTVRSPG
APGDPPRGPLELWIADPHTGTCRPALRHPAAAAAAAAAAMPLGLPYRGLN
TVFDDYAWLDDDTLVAAVLPDGLTAPPPPRPATPPGPKVTDNTAGKKAQN
RTWPDLLKDEYDMALFEHYGISELLRLNVRTGEVAVIGPPRMYIETDPSP
DGRYLLVTWLEKPYSTAVPCGRFPRRTQLWSRDGTLVRELAALPLAEDIP
IAFNSCRAGPRGISWRDDAPSEVYWLEAQDGGDPSVEVSPRDVVLALTAE
DAADPAVQPRQIAATDLRCGGVAWRVYVRVCDGELAIVFESWYKTRRSVW
WRFAPDQPREPKTVIFDRNYEDVYGDPGSPLTRRTRWGTYAIARGVGVAG
GGLCSGEGTWVLMSGSGASPEGNKPFLDLMQLESGETHRLWQSSPPHYEV
TGSLMSDTDPEAPLTVEGMSLMLSRETASDPPQSFLVAFRDAGRRRDERQ
VTNFPHPYPQLRELRREVLRYPRADGVMLTATLYLPPGYDQPTHGPLPCI
VWAYPREYKTKEAAGQMRRSPHQFSSIGSTSPTLWLTRGYAVLDGPTLPI
VADVQEGSETSHQGGPAEGSKAPEPNDTFVEQLTDGARAAVAEVVRRGVA
DPAKVSVGGHSYGAFMTANLVAHAPDLFAAGIARTXAYNRTLTPFGFQSE
ERTLWQAPDVYLRMSPFMMADKISKPLLLIHGEDDNNPGTFPLQSERFYQ
ALKGHGATCRLVLLPHEGHGYRAYESVMHTLYEQDQWIERYAGYGRLDPN
YLTDDTAGGTHIITFAAIIAAKICIIYPLFLGDCEQSTVVRELLSGER
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKQCGRRMIATWKEGSVFKQVLCHVGLSLGPYDLGVLARCPSRDMQSHSS
QPRTMARNSEVFTFAASSPDSWLSGSSPNGYKLPPPEIATIVDAPAQPSL
SYSPDRKTFLQLTRPPSLPPILEMSRPELKLAGLRVDPDLYARSKMSYYT
GISIVPATEVVPAPADKCRTLTGFPAGSWINYVSWSPDGTHIAFTVRSPG
APGDPPRGPLELWIADPHTGTCRPALRHPAAAAAAAAAAMPLGLPYRGLN
TVFDDYAWLDDDTLVAAVLPDGLTAPPPPRPATPPGPKVTDNTAGKKAQN
RTWPDLLKDEYDMALFEHYGISELLRLNVRTGEVAVIGPPRMYIETDPSP
DGRYLLVTWLEKPYSTAVPCGRFPRRTQLWSRDGTLVRELAALPLAEDIP
IAFNSCRAGPRGISWRDDAPSEVYWLEAQDGGDPSVEVSPRDVVLALTAE
DAADPAVQPRQIAATDLRCGGVAWRVYVRVCDGELAIVFESWYKTRRSVW
WRFAPDQPREPKTVIFDRNYEDVYGDPGSPLTRRTRWGTYAIARGVGVAG
GGLCSGEGTWVLMSGSGASPEGNKPFLDLMQLESGETHRLWQSSPPHYEV
TGSLMSDTDPEAPLTVEGMSLMLSRETASDPPQSFLVAFRDAGRRRDERQ
VTNFPHPYPQLRELRREVLRYPRADGVMLTATLYLPPGYDQPTHGPLPCI
VWAYPREYKTKEAAGQMRRSPHQFSSIGSTSPTLWLTRGYAVLDGPTLPI
VADVQEGSETSHQGGPAEGSKAPEPNDTFVEQLTDGARAAVAEVVRRGVA
DPAKVSVGGHSYGAFMTANLVAHAPDLFAAGIARTXAYNRTLTPFGFQSE
ERTLWQAPDVYLRMSPFMMADKISKPLLLIHGEDDNNPGTFPLQSERFYQ
ALKGHGATCRLVLLPHEGHGYRAYESVMHTLYEQDQWIERYAGYGRLDPN
YLTDDTAGGTHIITFAAIIAAKICIIYPLFLGDCEQSTVVRELLSGER


Reference
    Title: Genomic analysis of organismal complexity in the multicellular green alga Volvox carteri
    Prochnik SE, Umen J, Nedelcu AM, Hallmann A, Miller SM, Nishii I, Ferris P, Kuo A, Mitros T and Rokhsar DS <18 more author(s)>
    Ref: Science, 329:223, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer