Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanax-XAC0279

Xanthomonas axonopodis (pv. citri); Xanthomonas fuscans subsp.; Xanthomonas citri hypothetical protein xac0279

Comment
Other strains: Xanthomonas axonopodis (pv. citri); Xanthomonas fuscans subsp.; Xanthomonas citri; (Xanthomonas campestris pv. citri)


Relationship
Family|Atu1826-like
Block| X
Position in NCBI Life Tree|Xanthomonas axonopodis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas axonopodis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: xanax-XAC0279
Colored MSA for Atu1826-like (raw)
MSNPSFPTESAALTLEGPVGPLDVAVDLPEPDVAAHAVTAIFCHPLSTEG
GSMHNKVVTMAARALRELGITVVRFNFRSVGNSAGAFDHGVGEQDDLRAV
AEWVRAQQPGHTLWLGGFSFGAYVALRAACSLQPQVLISIAPPAGRWDFS
DIQPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPELVRMPDTSHFFHRK
LIDLRGAIQHGVRRWLPAAV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNPSFPTESAALTLEGPVGPLDVAVDLPEPDVAAHAVTAIFCHPLSTEG
GSMHNKVVTMAARALRELGITVVRFNFRSVGNSAGAFDHGVGEQDDLRAV
AEWVRAQQPGHTLWLGGFSFGAYVALRAACSLQPQVLISIAPPAGRWDFS
DIQPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPELVRMPDTSHFFHRK
LIDLRGAIQHGVRRWLPAAV


Reference
    Title: Comparison of the genomes of two Xanthomonas pathogens with differing host specificities
    da Silva ACR, Ferro JA, Reinach FC, Farah CS, Furlan LR, Quaggio RB, Monteiro-Vitorello CB, Van Sluys MA, Almeida Jr NF and Kitajima JP <55 more author(s)>
    Ref: Nature, 417:459, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer