xanax-XAC0628

Xanthomonas axonopodis, Xanthomonas campestris, Xanthomonas oryzae, Xanthomonas fuscans, Xanthomonas vesicatoria, Xanthomonas perforans, Xanthomonas gardneri, prolyl oligopeptidase

Comment

"Other strains: Xanthomonas axonopodis pv. citri (strain 306), Xanthomonas campestris pv. campestris (strains 8004\; B100\; ATCC 33913 \/ NCPPB 528 \/ LMG 568), pv. vesicatoria (strain 85-10), Xanthomonas oryzae pv. oryzae (strains KACC10331 \/ KXO85\; MAFF 311018\; PXO99A), Xanthomonas fuscans subsp. aurantifolii (strains: ICPB 10535\; ICPB 11122), Xanthomonas vesicatoria ATCC 35937, Xanthomonas perforans 91-118, Xanthomonas gardneri ATCC 19865"

Relationship

Family : S9N_PPCE_Peptidase_S9

Block : X

Position in NCBI Life Tree : Xanthomonas axonopodis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MPKFASICLVAGLITAGAVSAEEPPVSNDPYAWLEDVTGA
KPLDWVKTQN AKTEARLASTQAFKQMETSIREVLDSDAK
IPGVQKIGAFYYNFWKDKQHE RGLWRRTTLDEYRKATPK
WETVLDLDVLNKAEGENWVWHGADCLRPDYQR CLIALSR
GGADADVTREFDLGSKQWVKDGFFRPESKGGLGWIDRDTV
YVF TDFGAGSMTSSGYPRIAKQWKRGTPLTAATVVYEGK
PTDMYIAAMHDDTP GFERDFVSRTLAFYNDELYLKGADG
TLVKVDVPNSASKSVKRQWLTLELR EPWTVGGKTYKPGT
LLATRFDDFMAGKRNFDVLFEPTDTTSLAGMAWTKS HLV
LNVLEDVKNRLSVTTPSPDGWKKSAFVGAPSFGTVDVGAV
DSDDSDA LWLTVTDYLTPTTLSWVDVGAAPQPLKTMPAF
FDAGKDTIEQHFATSKDG TRVPYFLVRPKALKLDGSAPT
LLYGYGGFEISMTPNYSGGLGRAWLEKGG VYVVANIRGG
GEYGPRWHQAALKQNRHKAYEDMAAVAKDLVARKITSTKH
LGVQGGSNGGLMTGNMLTQYPELFGAVVVQVPLLDMKRY
SHLLAGASWMA EYGNPDTDDWTFIQTFSPYHLFDAKKTY
PPVIFLTSTRDDRVHPGHARKM AAKMIEAGKDVTYYENI
EGGHGGAANNAQAAHMAALAYSFLWERLAD

References

Title : Comparative and functional genomic analyses of the pathogenicity of phytopathogen Xanthomonas campestris pv. campestris - Qian_2005_Genome.Res_15_757
Author(s) : Qian W , Jia Y , Ren SX , He YQ , Feng JX , Lu LF , Sun Q , Ying G , Tang DJ , Tang H , Wu W , Hao P , Wang L , Jiang BL , Zeng S , Gu WY , Lu G , Rong L , Tian Y , Yao Z , Fu G , Chen B , Fang R , Qiang B , Chen Z , Zhao GP , Tang JL , He C
Ref : Genome Res , 15 :757 , 2005
Abstract : Qian_2005_Genome.Res_15_757
ESTHER : Qian_2005_Genome.Res_15_757
PubMedSearch : Qian_2005_Genome.Res_15_757
PubMedID: 15899963
Gene_locus related to this paper: xanax-DHAA , xanax-ENTF2 , xanax-GAA , xanax-PTRB , xanax-XAC0515 , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC0753 , xanax-XAC1713 , xanca-acvB , xanca-BIOH , xanca-CATD , xanca-CPO , xanca-estA1 , xanca-impep , xanca-META , xanca-METX , xanca-PCAD , xanca-PHBC , xanca-Q8PB04 , xanca-W78 , xanca-XCC0080 , xanca-XCC0180 , xanca-XCC0243 , xanca-XCC0266 , xanca-XCC0372 , xanca-XCC0375 , xanca-XCC0753 , xanca-XCC0800 , xanca-XCC0843 , xanca-XCC1105 , xanca-XCC1734 , xanca-XCC2285 , xanca-XCC2374 , xanca-XCC2397 , xanca-XCC2405 , xanca-XCC2566 , xanca-XCC2722 , xanca-XCC2737 , xanca-XCC2811 , xanca-XCC2817 , xanca-XCC2854 , xanca-XCC2869 , xanca-XCC3028 , xanca-XCC3164 , xanca-XCC3219 , xanca-XCC3296 , xanca-XCC3320 , xanca-XCC3514 , xanca-XCC3548 , xanca-XCC3555 , xanca-XCC3623 , xanca-XCC3915 , xanca-XCC3961 , xanca-XCC3970 , xanca-XCC4016 , xanca-XCC4096 , xanca-XCC4180 , xanca-XYNB , xanca-XYNB2 , xancb-b0rq23 , xancp-q8pax3 , xancp-y2094

Title : Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of large numbers of effector genes and insertion sequences to its race diversity - Ochiai_2005_Jpn.Agric.Res.Q_39_275
Author(s) : Inoue Y , Takeya M , Sasaki A , Kaki H
Ref : , 39 :275 , 2005
Abstract : Ochiai_2005_Jpn.Agric.Res.Q_39_275
ESTHER : Ochiai_2005_Jpn.Agric.Res.Q_39_275
PubMedSearch : Ochiai_2005_Jpn.Agric.Res.Q_39_275
PubMedID:
Gene_locus related to this paper: xanax-GAA , xanax-PTRB , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC1713 , xanax-XAC3152 , xanca-impep , xanca-XCC1105 , xanca-XCC2566 , xanor-acvB , xanor-bioh , xanor-metx , xanor-q5gu74 , xanor-q5guj3 , xanor-q5guw6 , xanor-q5gv06 , xanor-q5gvh5 , xanor-q5gvh6 , xanor-q5gvk9 , xanor-q5gwc8 , xanor-q5gy36 , xanor-q5gy47 , xanor-q5gyv6 , xanor-q5gz98 , xanor-q5h0m2 , xanor-q5h0p6 , xanor-q5h1g5 , xanor-q5h1l1 , xanor-q5h1v0 , xanor-q5h1w4 , xanor-q5h2y0 , xanor-q5h3e2 , xanor-q5h3e8 , xanor-q5h5m9 , xanor-q5h5n1 , xanor-q5h5s2 , xanor-q5h5w8 , xanor-q5h5x9 , xanor-q5h236 , xanor-Q93M73

Title : Insights into genome plasticity and pathogenicity of the plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete genome sequence - Thieme_2005_J.Bacteriol_187_7254
Author(s) : Thieme F , Koebnik R , Bekel T , Berger C , Boch J , Buttner D , Caldana C , Gaigalat L , Goesmann A , Kay S , Kirchner O , Lanz C , Linke B , McHardy AC , Meyer F , Mittenhuber G , Nies DH , Niesbach-Klosgen U , Patschkowski T , Ruckert C , Rupp O , Schneiker S , Schuster SC , Vorholter FJ , Weber E , Puhler A , Bonas U , Bartels D , Kaiser O
Ref : Journal of Bacteriology , 187 :7254 , 2005
Abstract : Thieme_2005_J.Bacteriol_187_7254
ESTHER : Thieme_2005_J.Bacteriol_187_7254
PubMedSearch : Thieme_2005_J.Bacteriol_187_7254
PubMedID: 16237009
Gene_locus related to this paper: xanac-q8pmm6 , xanax-ACVB , xanax-BIOH , xanax-CATD , xanax-CPO , xanax-DHAA , xanax-ENTF2 , xanax-GAA , xanax-META , xanax-METX , xanax-PCAD , xanax-PHBC , xanax-PTRB , xanax-Q8PMQ8 , xanax-XAC0198 , xanax-XAC0262 , xanax-XAC0319 , xanax-XAC0372 , xanax-XAC0375 , xanax-XAC0515 , xanax-XAC0574 , xanax-XAC0591 , xanax-XAC0619 , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC0753 , xanax-XAC0805 , xanax-XAC0874 , xanax-XAC1200 , xanax-XAC1213 , xanax-XAC1713 , xanax-XAC2532 , xanax-XAC2541 , xanax-XAC2907 , xanax-XAC2981 , xanax-XAC2990 , xanax-XAC3037 , xanax-XAC3053 , xanax-XAC3152 , xanax-XAC3770 , xanax-XAC3999 , xanax-XAC4046 , xanax-XAC4055 , xanax-XAC4106 , xanax-XAC4221 , xanax-XAC4316 , xanax-XYNB , xanc5-q3bqi2 , xanc5-q3bst4 , xanc5-q3btn4 , xanc5-q3bup9 , xanc5-q3byx0 , xanca-estA1 , xanca-impep , xanca-XCC1105 , xanca-XCC2285 , xanca-XCC2566 , xanca-XCC2722 , xanca-XCC3164 , xanca-XCC3555 , xanor-q5h3e8

Title : Comparison of the genomes of two Xanthomonas pathogens with differing host specificities - da Silva_2002_Nature_417_459
Author(s) : da Silva ACR , Ferro JA , Reinach FC , Farah CS , Furlan LR , Quaggio RB , Monteiro-Vitorello CB , Van Sluys MA , Almeida Jr NF , Alves LMC , do Amaral AM , Bertolini MC , Camargo LEA , Camarotte G , Cannavan F , Cardozo J , Chambergo F , Ciapina LP , Cicarelli RMB , Coutinho LL , Cursino-Santos JR , El-Dorry H , Faria JB , Ferreira AJS , Ferreira RCC , Ferro MIT , Formighieri EF , Franco MC , Greggio CC , Gruber A , Katsuyama AM , Kishi LT , Leite JrRP , Lemos EGM , Lemos MVF , Locali EC , Machado MA , Madeira AMBN , Martinez-Rossi NM , Martins EC , Meidanis J , Menck CFM , Miyaki CY , Moon DH , Moreira LM , Novo MTM , Okura VK , Oliveira MC , Oliveira VR , Pereira Jr HA , Rossi A , Sena JAD , Silva C , de Souza RF , Spinola LAF , Takita MA , Tamura RE , Teixeira EC , Tezza RID , Trindade dos Santos M , Truffi D , Tsai SM , White FF , Setubal JC , Kitajima JP
Ref : Nature , 417 :459 , 2002
Abstract : da Silva_2002_Nature_417_459
ESTHER : da Silva_2002_Nature_417_459
PubMedSearch : da Silva_2002_Nature_417_459
PubMedID: 12024217
Gene_locus related to this paper: xanac-q8phx9 , xanac-q8pmm6 , xanax-ACVB , xanax-BIOH , xanax-CATD , xanax-CPO , xanax-DHAA , xancp-OleB , xanax-ENTF2 , xanax-estA1 , xanax-GAA , xanax-META , xanax-METX , xanax-PCAD , xanax-PHBC , xanax-PTRB , xanax-Q8PMQ8 , xanax-Q8PQP0 , xanax-XAC0198 , xanax-XAC0262 , xanax-XAC0279 , xanax-XAC0319 , xanax-XAC0372 , xanax-XAC0375 , xanax-XAC0501 , xanax-XAC0515 , xanax-XAC0574 , xanax-XAC0591 , xanax-XAC0619 , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC0753 , xanax-XAC0805 , xanax-XAC0874 , xanax-XAC0916 , xanax-XAC1200 , xanax-XAC1213 , xanax-XAC1591 , xanax-XAC1713 , xanax-XAC1752 , xanax-XAC2126 , xanax-XAC2393 , xanax-XAC2532 , xanax-XAC2541 , xanax-XAC2907 , xanax-XAC2981 , xanax-XAC2987 , xanax-XAC2990 , xanax-XAC3037 , xanax-XAC3053 , xanax-XAC3152 , xanax-XAC3173 , xanax-XAC3315 , xanax-XAC3371 , xanax-XAC3619 , xanax-XAC3674 , xanax-XAC3770 , xanax-XAC3967 , xanax-XAC3999 , xanax-XAC4046 , xanax-XAC4055 , xanax-XAC4106 , xanax-XAC4221 , xanax-XAC4316 , xanax-XYNB , xanca-acvB , xanca-BIOH , xanca-CATD , xanca-CPO , xanca-estA1 , xanca-impep , xanca-META , xanca-METX , xanca-PCAD , xanca-PHBC , xanca-Q8PB04 , xanca-W78 , xanca-XCC0080 , xanca-XCC0180 , xanca-XCC0243 , xanca-XCC0260 , xanca-XCC0266 , xanca-XCC0372 , xanca-XCC0375 , xanca-XCC0753 , xanca-XCC0757 , xanca-XCC0800 , xanca-XCC0843 , xanca-XCC1105 , xanca-XCC1541 , xanca-XCC1734 , xanca-XCC2285 , xanca-XCC2374 , xanca-XCC2397 , xanca-XCC2405 , xanca-XCC2566 , xanca-XCC2722 , xanca-XCC2737 , xanca-XCC2811 , xanca-XCC2817 , xanca-XCC2854 , xanca-XCC2869 , xanca-XCC2957 , xanca-XCC3028 , xanca-XCC3164 , xanca-XCC3219 , xanca-XCC3296 , xanca-XCC3300 , xanca-XCC3308 , xanca-XCC3320 , xanca-XCC3514 , xanca-XCC3548 , xanca-XCC3555 , xanca-XCC3623 , xanca-XCC3885 , xanca-XCC3915 , xanca-XCC3961 , xanca-XCC3970 , xanca-XCC4016 , xanca-XCC4096 , xanca-XCC4180 , xanca-XYNB , xanca-XYNB2 , xancb-b0rq23 , xancp-q8pax3 , xancp-y2094