xanca-XCC2817

Xanthomonas campestris (pv. campestris) (and strains 8004; B100) proline imino-peptidase

Comment

Relationship

Family : Proline_iminopeptidase

Block : X

Position in NCBI Life Tree : Xanthomonas campestris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MQCTEGFVEFRGYRTWYRITGDLHSDACPLIVLHGGPGCT
HDYVDSFTDL AGSGRAVIHYDQLGNGHSTHLPNADPSFW
TVGLFLDELQALISHLGLAQY ALLGQSWGGMLAAEHAVR
RPAGLRALVIANSPASMGLWRAAALRLRARLP EPVQAAL
DEHEAAGTLDSPAYRAATQAFYAQHVCRVLPWPAEVALTF
AAI DADPTVYHAMNGPTEFHVVGSLRNWSIIERLHRITA
PTLVLSGKYDEATP ETVEPYARLIPDARWHVFPNSSHMP
HVEEREACMRLVGNFLDDHSPWPGG QLTRPSALANRAV

References

Title : Comparative and functional genomic analyses of the pathogenicity of phytopathogen Xanthomonas campestris pv. campestris - Qian_2005_Genome.Res_15_757
Author(s) : Qian W , Jia Y , Ren SX , He YQ , Feng JX , Lu LF , Sun Q , Ying G , Tang DJ , Tang H , Wu W , Hao P , Wang L , Jiang BL , Zeng S , Gu WY , Lu G , Rong L , Tian Y , Yao Z , Fu G , Chen B , Fang R , Qiang B , Chen Z , Zhao GP , Tang JL , He C
Ref : Genome Res , 15 :757 , 2005
Abstract : Qian_2005_Genome.Res_15_757
ESTHER : Qian_2005_Genome.Res_15_757
PubMedSearch : Qian_2005_Genome.Res_15_757
PubMedID: 15899963
Gene_locus related to this paper: xanax-DHAA , xanax-ENTF2 , xanax-GAA , xanax-PTRB , xanax-XAC0515 , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC0753 , xanax-XAC1713 , xanca-acvB , xanca-BIOH , xanca-CATD , xanca-CPO , xanca-estA1 , xanca-impep , xanca-META , xanca-METX , xanca-PCAD , xanca-PHBC , xanca-Q8PB04 , xanca-W78 , xanca-XCC0080 , xanca-XCC0180 , xanca-XCC0243 , xanca-XCC0266 , xanca-XCC0372 , xanca-XCC0375 , xanca-XCC0753 , xanca-XCC0800 , xanca-XCC0843 , xanca-XCC1105 , xanca-XCC1734 , xanca-XCC2285 , xanca-XCC2374 , xanca-XCC2397 , xanca-XCC2405 , xanca-XCC2566 , xanca-XCC2722 , xanca-XCC2737 , xanca-XCC2811 , xanca-XCC2817 , xanca-XCC2854 , xanca-XCC2869 , xanca-XCC3028 , xanca-XCC3164 , xanca-XCC3219 , xanca-XCC3296 , xanca-XCC3320 , xanca-XCC3514 , xanca-XCC3548 , xanca-XCC3555 , xanca-XCC3623 , xanca-XCC3915 , xanca-XCC3961 , xanca-XCC3970 , xanca-XCC4016 , xanca-XCC4096 , xanca-XCC4180 , xanca-XYNB , xanca-XYNB2 , xancb-b0rq23 , xancp-q8pax3 , xancp-y2094

Title : Comparison of the genomes of two Xanthomonas pathogens with differing host specificities - da Silva_2002_Nature_417_459
Author(s) : da Silva ACR , Ferro JA , Reinach FC , Farah CS , Furlan LR , Quaggio RB , Monteiro-Vitorello CB , Van Sluys MA , Almeida Jr NF , Alves LMC , do Amaral AM , Bertolini MC , Camargo LEA , Camarotte G , Cannavan F , Cardozo J , Chambergo F , Ciapina LP , Cicarelli RMB , Coutinho LL , Cursino-Santos JR , El-Dorry H , Faria JB , Ferreira AJS , Ferreira RCC , Ferro MIT , Formighieri EF , Franco MC , Greggio CC , Gruber A , Katsuyama AM , Kishi LT , Leite JrRP , Lemos EGM , Lemos MVF , Locali EC , Machado MA , Madeira AMBN , Martinez-Rossi NM , Martins EC , Meidanis J , Menck CFM , Miyaki CY , Moon DH , Moreira LM , Novo MTM , Okura VK , Oliveira MC , Oliveira VR , Pereira Jr HA , Rossi A , Sena JAD , Silva C , de Souza RF , Spinola LAF , Takita MA , Tamura RE , Teixeira EC , Tezza RID , Trindade dos Santos M , Truffi D , Tsai SM , White FF , Setubal JC , Kitajima JP
Ref : Nature , 417 :459 , 2002
Abstract : da Silva_2002_Nature_417_459
ESTHER : da Silva_2002_Nature_417_459
PubMedSearch : da Silva_2002_Nature_417_459
PubMedID: 12024217
Gene_locus related to this paper: xanac-q8phx9 , xanac-q8pmm6 , xanax-ACVB , xanax-BIOH , xanax-CATD , xanax-CPO , xanax-DHAA , xancp-OleB , xanax-ENTF2 , xanax-estA1 , xanax-GAA , xanax-META , xanax-METX , xanax-PCAD , xanax-PHBC , xanax-PTRB , xanax-Q8PMQ8 , xanax-Q8PQP0 , xanax-XAC0198 , xanax-XAC0262 , xanax-XAC0279 , xanax-XAC0319 , xanax-XAC0372 , xanax-XAC0375 , xanax-XAC0501 , xanax-XAC0515 , xanax-XAC0574 , xanax-XAC0591 , xanax-XAC0619 , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC0753 , xanax-XAC0805 , xanax-XAC0874 , xanax-XAC0916 , xanax-XAC1200 , xanax-XAC1213 , xanax-XAC1591 , xanax-XAC1713 , xanax-XAC1752 , xanax-XAC2126 , xanax-XAC2393 , xanax-XAC2532 , xanax-XAC2541 , xanax-XAC2907 , xanax-XAC2981 , xanax-XAC2987 , xanax-XAC2990 , xanax-XAC3037 , xanax-XAC3053 , xanax-XAC3152 , xanax-XAC3173 , xanax-XAC3315 , xanax-XAC3371 , xanax-XAC3619 , xanax-XAC3674 , xanax-XAC3770 , xanax-XAC3967 , xanax-XAC3999 , xanax-XAC4046 , xanax-XAC4055 , xanax-XAC4106 , xanax-XAC4221 , xanax-XAC4316 , xanax-XYNB , xanca-acvB , xanca-BIOH , xanca-CATD , xanca-CPO , xanca-estA1 , xanca-impep , xanca-META , xanca-METX , xanca-PCAD , xanca-PHBC , xanca-Q8PB04 , xanca-W78 , xanca-XCC0080 , xanca-XCC0180 , xanca-XCC0243 , xanca-XCC0260 , xanca-XCC0266 , xanca-XCC0372 , xanca-XCC0375 , xanca-XCC0753 , xanca-XCC0757 , xanca-XCC0800 , xanca-XCC0843 , xanca-XCC1105 , xanca-XCC1541 , xanca-XCC1734 , xanca-XCC2285 , xanca-XCC2374 , xanca-XCC2397 , xanca-XCC2405 , xanca-XCC2566 , xanca-XCC2722 , xanca-XCC2737 , xanca-XCC2811 , xanca-XCC2817 , xanca-XCC2854 , xanca-XCC2869 , xanca-XCC2957 , xanca-XCC3028 , xanca-XCC3164 , xanca-XCC3219 , xanca-XCC3296 , xanca-XCC3300 , xanca-XCC3308 , xanca-XCC3320 , xanca-XCC3514 , xanca-XCC3548 , xanca-XCC3555 , xanca-XCC3623 , xanca-XCC3885 , xanca-XCC3915 , xanca-XCC3961 , xanca-XCC3970 , xanca-XCC4016 , xanca-XCC4096 , xanca-XCC4180 , xanca-XYNB , xanca-XYNB2 , xancb-b0rq23 , xancp-q8pax3 , xancp-y2094