xanax-XAC3152

Xanthomonas axonopodis; Xanthomonas campestris; Xanthomonas oryzae; hypothetical protein xac3152

Comment

"Other strains: Xanthomonas axonopodis (pv. citri\; pv. vasculorum) Xanthomonas campestris pv. vesicatoria (strain 85-10) pv. musacearum NCPPB 2005, Xanthomonas oryzae pv. oryzae (and strain MAFF 311018)\;"

Relationship

Family : 6_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Xanthomonas axonopodis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MLLVHGIWNTAHWLLPLARRMRANGLAPALFGYASVLGGP
AQAVPHLIER LRASRVQLVICHSLGGLMTLQALQDAPDL
PVGRVVCLGSPLCGSAAARGL AQRGGRWAMGRSAAILQQ
GFARWDGQAEIGQVAGNVALAETRLPGLRDHC VVRASHS
GLLRSPEAAAQALAFLRTGRFQA

References

Title : Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of large numbers of effector genes and insertion sequences to its race diversity - Ochiai_2005_Jpn.Agric.Res.Q_39_275
Author(s) : Inoue Y , Takeya M , Sasaki A , Kaki H
Ref : , 39 :275 , 2005
Abstract : Ochiai_2005_Jpn.Agric.Res.Q_39_275
ESTHER : Ochiai_2005_Jpn.Agric.Res.Q_39_275
PubMedSearch : Ochiai_2005_Jpn.Agric.Res.Q_39_275
PubMedID:
Gene_locus related to this paper: xanax-GAA , xanax-PTRB , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC1713 , xanax-XAC3152 , xanca-impep , xanca-XCC1105 , xanca-XCC2566 , xanor-acvB , xanor-bioh , xanor-metx , xanor-q5gu74 , xanor-q5guj3 , xanor-q5guw6 , xanor-q5gv06 , xanor-q5gvh5 , xanor-q5gvh6 , xanor-q5gvk9 , xanor-q5gwc8 , xanor-q5gy36 , xanor-q5gy47 , xanor-q5gyv6 , xanor-q5gz98 , xanor-q5h0m2 , xanor-q5h0p6 , xanor-q5h1g5 , xanor-q5h1l1 , xanor-q5h1v0 , xanor-q5h1w4 , xanor-q5h2y0 , xanor-q5h3e2 , xanor-q5h3e8 , xanor-q5h5m9 , xanor-q5h5n1 , xanor-q5h5s2 , xanor-q5h5w8 , xanor-q5h5x9 , xanor-q5h236 , xanor-Q93M73

Title : Insights into genome plasticity and pathogenicity of the plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete genome sequence - Thieme_2005_J.Bacteriol_187_7254
Author(s) : Thieme F , Koebnik R , Bekel T , Berger C , Boch J , Buttner D , Caldana C , Gaigalat L , Goesmann A , Kay S , Kirchner O , Lanz C , Linke B , McHardy AC , Meyer F , Mittenhuber G , Nies DH , Niesbach-Klosgen U , Patschkowski T , Ruckert C , Rupp O , Schneiker S , Schuster SC , Vorholter FJ , Weber E , Puhler A , Bonas U , Bartels D , Kaiser O
Ref : Journal of Bacteriology , 187 :7254 , 2005
Abstract : Thieme_2005_J.Bacteriol_187_7254
ESTHER : Thieme_2005_J.Bacteriol_187_7254
PubMedSearch : Thieme_2005_J.Bacteriol_187_7254
PubMedID: 16237009
Gene_locus related to this paper: xanac-q8pmm6 , xanax-ACVB , xanax-BIOH , xanax-CATD , xanax-CPO , xanax-DHAA , xanax-ENTF2 , xanax-GAA , xanax-META , xanax-METX , xanax-PCAD , xanax-PHBC , xanax-PTRB , xanax-Q8PMQ8 , xanax-XAC0198 , xanax-XAC0262 , xanax-XAC0319 , xanax-XAC0372 , xanax-XAC0375 , xanax-XAC0515 , xanax-XAC0574 , xanax-XAC0591 , xanax-XAC0619 , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC0753 , xanax-XAC0805 , xanax-XAC0874 , xanax-XAC1200 , xanax-XAC1213 , xanax-XAC1713 , xanax-XAC2532 , xanax-XAC2541 , xanax-XAC2907 , xanax-XAC2981 , xanax-XAC2990 , xanax-XAC3037 , xanax-XAC3053 , xanax-XAC3152 , xanax-XAC3770 , xanax-XAC3999 , xanax-XAC4046 , xanax-XAC4055 , xanax-XAC4106 , xanax-XAC4221 , xanax-XAC4316 , xanax-XYNB , xanc5-q3bqi2 , xanc5-q3bst4 , xanc5-q3btn4 , xanc5-q3bup9 , xanc5-q3byx0 , xanca-estA1 , xanca-impep , xanca-XCC1105 , xanca-XCC2285 , xanca-XCC2566 , xanca-XCC2722 , xanca-XCC3164 , xanca-XCC3555 , xanor-q5h3e8

Title : Comparison of the genomes of two Xanthomonas pathogens with differing host specificities - da Silva_2002_Nature_417_459
Author(s) : da Silva ACR , Ferro JA , Reinach FC , Farah CS , Furlan LR , Quaggio RB , Monteiro-Vitorello CB , Van Sluys MA , Almeida Jr NF , Alves LMC , do Amaral AM , Bertolini MC , Camargo LEA , Camarotte G , Cannavan F , Cardozo J , Chambergo F , Ciapina LP , Cicarelli RMB , Coutinho LL , Cursino-Santos JR , El-Dorry H , Faria JB , Ferreira AJS , Ferreira RCC , Ferro MIT , Formighieri EF , Franco MC , Greggio CC , Gruber A , Katsuyama AM , Kishi LT , Leite JrRP , Lemos EGM , Lemos MVF , Locali EC , Machado MA , Madeira AMBN , Martinez-Rossi NM , Martins EC , Meidanis J , Menck CFM , Miyaki CY , Moon DH , Moreira LM , Novo MTM , Okura VK , Oliveira MC , Oliveira VR , Pereira Jr HA , Rossi A , Sena JAD , Silva C , de Souza RF , Spinola LAF , Takita MA , Tamura RE , Teixeira EC , Tezza RID , Trindade dos Santos M , Truffi D , Tsai SM , White FF , Setubal JC , Kitajima JP
Ref : Nature , 417 :459 , 2002
Abstract : da Silva_2002_Nature_417_459
ESTHER : da Silva_2002_Nature_417_459
PubMedSearch : da Silva_2002_Nature_417_459
PubMedID: 12024217
Gene_locus related to this paper: xanac-q8phx9 , xanac-q8pmm6 , xanax-ACVB , xanax-BIOH , xanax-CATD , xanax-CPO , xanax-DHAA , xancp-OleB , xanax-ENTF2 , xanax-estA1 , xanax-GAA , xanax-META , xanax-METX , xanax-PCAD , xanax-PHBC , xanax-PTRB , xanax-Q8PMQ8 , xanax-Q8PQP0 , xanax-XAC0198 , xanax-XAC0262 , xanax-XAC0279 , xanax-XAC0319 , xanax-XAC0372 , xanax-XAC0375 , xanax-XAC0501 , xanax-XAC0515 , xanax-XAC0574 , xanax-XAC0591 , xanax-XAC0619 , xanax-XAC0628 , xanax-XAC0736 , xanax-XAC0753 , xanax-XAC0805 , xanax-XAC0874 , xanax-XAC0916 , xanax-XAC1200 , xanax-XAC1213 , xanax-XAC1591 , xanax-XAC1713 , xanax-XAC1752 , xanax-XAC2126 , xanax-XAC2393 , xanax-XAC2532 , xanax-XAC2541 , xanax-XAC2907 , xanax-XAC2981 , xanax-XAC2987 , xanax-XAC2990 , xanax-XAC3037 , xanax-XAC3053 , xanax-XAC3152 , xanax-XAC3173 , xanax-XAC3315 , xanax-XAC3371 , xanax-XAC3619 , xanax-XAC3674 , xanax-XAC3770 , xanax-XAC3967 , xanax-XAC3999 , xanax-XAC4046 , xanax-XAC4055 , xanax-XAC4106 , xanax-XAC4221 , xanax-XAC4316 , xanax-XYNB , xanca-acvB , xanca-BIOH , xanca-CATD , xanca-CPO , xanca-estA1 , xanca-impep , xanca-META , xanca-METX , xanca-PCAD , xanca-PHBC , xanca-Q8PB04 , xanca-W78 , xanca-XCC0080 , xanca-XCC0180 , xanca-XCC0243 , xanca-XCC0260 , xanca-XCC0266 , xanca-XCC0372 , xanca-XCC0375 , xanca-XCC0753 , xanca-XCC0757 , xanca-XCC0800 , xanca-XCC0843 , xanca-XCC1105 , xanca-XCC1541 , xanca-XCC1734 , xanca-XCC2285 , xanca-XCC2374 , xanca-XCC2397 , xanca-XCC2405 , xanca-XCC2566 , xanca-XCC2722 , xanca-XCC2737 , xanca-XCC2811 , xanca-XCC2817 , xanca-XCC2854 , xanca-XCC2869 , xanca-XCC2957 , xanca-XCC3028 , xanca-XCC3164 , xanca-XCC3219 , xanca-XCC3296 , xanca-XCC3300 , xanca-XCC3308 , xanca-XCC3320 , xanca-XCC3514 , xanca-XCC3548 , xanca-XCC3555 , xanca-XCC3623 , xanca-XCC3885 , xanca-XCC3915 , xanca-XCC3961 , xanca-XCC3970 , xanca-XCC4016 , xanca-XCC4096 , xanca-XCC4180 , xanca-XYNB , xanca-XYNB2 , xancb-b0rq23 , xancp-q8pax3 , xancp-y2094