Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanax-XAC0916

Xanthomonas axonopodis (pv. citri) hydrolase

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Xanthomonas axonopodis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas axonopodis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE011723
1 UniProt : Q8PNX3
1 Interpro : Q8PNX3
1 Pfam : Q8PNX3
1 PIRSF : Q8PNX3
1 SUPERFAM : Q8PNX3
Sequence
Graphical view for this peptide sequence: xanax-XAC0916
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSSSIATLRRRLLRGSLAGASRLAPGPTGRYLARRFVTPAALGRRQAATI
AATLTDMQRHTLRIDDIDIAMYQWGDPAQQRYVLLSHGWASYALRFAAWV
PQLRALGYAVVAFDQAAHGLSGGRISYMPHFVKMLRVIGSRFGRPAAFIG
HSLGAASVVFADDPVWRPARYVLIAPLLAPAASAQRQFRAFGIAPAAFAP
FENWLADLTGKRFSDFDATPRLPQFDRPALIIPDRRDRETPWDEGARFAS
LWPGAQLFTTEGLGHNRMVDHTSVIERAMQFIGPA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSSIATLRRRLLRGSLAGASRLAPGPTGRYLARRFVTPAALGRRQAATI
AATLTDMQRHTLRIDDIDIAMYQWGDPAQQRYVLLSHGWASYALRFAAWV
PQLRALGYAVVAFDQAAHGLSGGRISYMPHFVKMLRVIGSRFGRPAAFIG
HSLGAASVVFADDPVWRPARYVLIAPLLAPAASAQRQFRAFGIAPAAFAP
FENWLADLTGKRFSDFDATPRLPQFDRPALIIPDRRDRETPWDEGARFAS
LWPGAQLFTTEGLGHNRMVDHTSVIERAMQFIGPA


Reference
    Title: Comparison of the genomes of two Xanthomonas pathogens with differing host specificities
    da Silva ACR, Ferro JA, Reinach FC, Farah CS, Furlan LR, Quaggio RB, Monteiro-Vitorello CB, Van Sluys MA, Almeida Jr NF and Kitajima JP <55 more author(s)>
    Ref: Nature, 417:459, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer