Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-yj68

Saccharomyces cerevisiae (Baker's yeast) (and strain AWRI1631) hypothetical 74.1 kda protein in acr1-yuh1 intergenic region

Comment
only c -term Pfam A LACT 308 598


Relationship
Family|PC-sterol_acyltransferase
Block| L
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : Z49598, ABSV01001377
2 UniProt : P47139, B5VLP4
2 UniProt : P47139, B5VLP4
2 Interpro : P47139, B5VLP4
2 Prodom : P47139, B5VLP4
2 Pfam : P47139, B5VLP4
2 PIRSF : P47139, B5VLP4
2 SUPERFAM : P47139, B5VLP4
Sequence
Graphical view for this peptide sequence: yeast-yj68
Colored MSA for PC-sterol_acyltransferase (raw)
WNELEGDVVIMGGYRGSVLRDATTHKRIWIPLKAGLNMTKVDLLIGPNDE
DELKTQKEIVPDGMLTHIGPVDISKRLIKRLDANPNLNVQQFGYDWRLSL
DISAKHLTTKLEEIYNKQKNKKGIYIIAHSMGGLVAHKVLQDCTHLIRGI
IYVGSPSQCPNILGPIRFGDDVMWNKLFSLRTNFFMRSSFYFLPLDGRCF
VDKITLERYDFDFFDTDVWKTLGLSPLVNEKREESAHEKSKLLPRKTKSA
LSLKATLNATTKFVLNAPVVRNVAGNNKQVPRDVPFDEVFHTSYEDSCEY
LARTLKRTKNYLDSLDYDPNKEYPPLAMVYGNKVPTVRGAKVNGIQDIKD
GNYEDFYYGPGDGVVHHKWLLPEQRGFP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

WNELEGDVVIMGGYRGSVLRDATTHKRIWIPLKAGLNMTKVDLLIGPNDE
DELKTQKEIVPDGMLTHIGPVDISKRLIKRLDANPNLNVQQFGYDWRLSL
DISAKHLTTKLEEIYNKQKNKKGIYIIAHSMGGLVAHKVLQDCTHLIRGI
IYVGSPSQCPNILGPIRFGDDVMWNKLFSLRTNFFMRSSFYFLPLDGRCF
VDKITLERYDFDFFDTDVWKTLGLSPLVNEKREESAHEKSKLLPRKTKSA
LSLKATLNATTKFVLNAPVVRNVAGNNKQVPRDVPFDEVFHTSYEDSCEY
LARTLKRTKNYLDSLDYDPNKEYPPLAMVYGNKVPTVRGAKVNGIQDIKD
GNYEDFYYGPGDGVVHHKWLLPEQRGFP


References
    Title: Comparative genome analysis of a Saccharomyces cerevisiae wine strain
    Borneman AR, Forgan AH, Pretorius IS, Chambers PJ
    Ref: FEMS Yeast Res, 8:1185, 2008 : PubMed

            

    Title: Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X
    Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, de Haan M and et al. <16 more author(s)>
    Ref: EMBO Journal, 15:2031, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer