yeast-YDR428C

Saccharomyces cerevisiae (Baker's yeast); Saccharomyces sp. Kynurenine formamidase KFA d9461.15p

Comment

"Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites. Other strains: Saccharomyces cerevisiae (strains FostersB\; Zymaflore VL3\; JAY291\; AWRI796\; Lalvin QA23\; YJM789\; AWRI1631\; ATCC 204508 \/ S288c\; RM11-1a\; YJM993\; P301\; R103\; Kyokai no. 7 \/ NBRC 101557\; CEN.PK113-7D\; R008\; P283)\; Saccharomyces sp."

Relationship

Family : Kynurenine-formamidase

Block : H

Position in NCBI Life Tree : Saccharomyces cerevisiae

Molecular evidence

No mutation

No kinetic

No disease

No inhibitor

Sequence

Peptide

MSNTVRAISPDITLFNKTLTFQEISQNTREAVIYIHGGAW
NDPENTPNDF NQLANTIKSMDTESTVCQYSIEYRLSPEI
TNPRNLYDAVSNITRLVKEKG LTNINMVGHSVGATFIWQ
ILAALKDPQEKMSEAQLQMLGLLQIVKRVFLL DGIYSLK
ELLVEYPEYDCFTRLAFPDGIQMYEEEPSRVMPYVKKALS
RFS IDMHLVHSYSDELLTLRQTNCLISCLQDYQLSFKLY
LDDLGLHNDVYKNG KVAKYIFDNIC

References

Title : The impact of genomic variability on gene expression in environmental Saccharomyces cerevisiae strains - Treu_2014_Environ.Microbiol_16_1378
Author(s) : Treu L , Toniolo C , Nadai C , Sardu A , Giacomini A , Corich V , Campanaro S
Ref : Environ Microbiol , 16 :1378 , 2014
Abstract : Treu_2014_Environ.Microbiol_16_1378
ESTHER : Treu_2014_Environ.Microbiol_16_1378
PubMedSearch : Treu_2014_Environ.Microbiol_16_1378
PubMedID: 24238297
Gene_locus related to this paper: yeast-YDR428C

Title : De novo sequencing, assembly and analysis of the genome of the laboratory strain Saccharomyces cerevisiae CEN.PK113-7D, a model for modern industrial biotechnology - Nijkamp_2012_Microb.Cell.Fact_11_36
Author(s) : Nijkamp JF , van den Broek M , Datema E , de Kok S , Bosman L , Luttik MA , Daran-Lapujade P , Vongsangnak W , Nielsen J , Heijne WH , Klaassen P , Paddon CJ , Platt D , Kotter P , van Ham RC , Reinders MJ , Pronk JT , de Ridder D , Daran JM
Ref : Microb Cell Fact , 11 :36 , 2012
Abstract : Nijkamp_2012_Microb.Cell.Fact_11_36
ESTHER : Nijkamp_2012_Microb.Cell.Fact_11_36
PubMedSearch : Nijkamp_2012_Microb.Cell.Fact_11_36
PubMedID: 22448915
Gene_locus related to this paper: yeast-YDR428C , yeast-hda1

Title : Whole-genome sequencing of sake yeast Saccharomyces cerevisiae Kyokai no. 7 - Akao_2011_DNA.Res_18_423
Author(s) : Akao T , Yashiro I , Hosoyama A , Kitagaki H , Horikawa H , Watanabe D , Akada R , Ando Y , Harashima S , Inoue T , Inoue Y , Kajiwara S , Kitamoto K , Kitamoto N , Kobayashi O , Kuhara S , Masubuchi T , Mizoguchi H , Nakao Y , Nakazato A , Namise M , Oba T , Ogata T , Ohta A , Sato M , Shibasaki S , Takatsume Y , Tanimoto S , Tsuboi H , Nishimura A , Yoda K , Ishikawa T , Iwashita K , Fujita N , Shimoi H
Ref : DNA Research , 18 :423 , 2011
Abstract : Akao_2011_DNA.Res_18_423
ESTHER : Akao_2011_DNA.Res_18_423
PubMedSearch : Akao_2011_DNA.Res_18_423
PubMedID: 21900213
Gene_locus related to this paper: yeast-YDR428C , yeast-hda1

Title : Eukaryote-to-eukaryote gene transfer events revealed by the genome sequence of the wine yeast Saccharomyces cerevisiae EC1118 - Novo_2009_Proc.Natl.Acad.Sci.U.S.A_106_16333
Author(s) : Novo M , Bigey F , Beyne E , Galeote V , Gavory F , Mallet S , Cambon B , Legras JL , Wincker P , Casaregola S , Dequin S
Ref : Proc Natl Acad Sci U S A , 106 :16333 , 2009
Abstract : Novo_2009_Proc.Natl.Acad.Sci.U.S.A_106_16333
ESTHER : Novo_2009_Proc.Natl.Acad.Sci.U.S.A_106_16333
PubMedSearch : Novo_2009_Proc.Natl.Acad.Sci.U.S.A_106_16333
PubMedID: 19805302
Gene_locus related to this paper: yeast-AIM2 , yeast-BST1 , yeast-cbpy1 , yeast-cld1 , yeast-dap1 , yeast-dap2 , yeast-dlhh , yeast-ECM18 , yeast-FSH1 , yeast-FSH3 , yeast-ict1 , yeast-kex01 , yeast-MCFS1 , yeast-MCFS2 , yeast-met2 , yeast-mgll , yeast-pdat , yeast-ppme1 , yeast-ROG1 , yeast-SAY1 , yeast-tgl1 , yeast-tgl2 , yeast-yby9 , yeast-YDL109C , yeast-YDR428C , yeast-YDR444W , yeast-yg19 , yeast-yj77 , yeast-yjg8 , yeast-YLL012W , yeast-YLR020C , yeast-YLR118c , yeast-ym60 , yeast-ynl5 , yeast-yo059 , yeast-YPR147C , yeast-hda1

Title : Identification of formyl kynurenine formamidase and kynurenine aminotransferase from Saccharomyces cerevisiae using crystallographic, bioinformatic and biochemical evidence - Wogulis_2008_Biochemistry_47_1608
Author(s) : Wogulis M , Chew ER , Donohoue PD , Wilson DK
Ref : Biochemistry , 47 :1608 , 2008
Abstract : Wogulis_2008_Biochemistry_47_1608
ESTHER : Wogulis_2008_Biochemistry_47_1608
PubMedSearch : Wogulis_2008_Biochemistry_47_1608
PubMedID: 18205391
Gene_locus related to this paper: yeast-YDR428C

Title : A multidimensional chromatography technology for in-depth phosphoproteome analysis - Albuquerque_2008_Mol.Cell.Proteomics_7_1389
Author(s) : Albuquerque CP , Smolka MB , Payne SH , Bafna V , Eng J , Zhou H
Ref : Mol Cell Proteomics , 7 :1389 , 2008
Abstract : Albuquerque_2008_Mol.Cell.Proteomics_7_1389
ESTHER : Albuquerque_2008_Mol.Cell.Proteomics_7_1389
PubMedSearch : Albuquerque_2008_Mol.Cell.Proteomics_7_1389
PubMedID: 18407956
Gene_locus related to this paper: yeast-YDR428C , yeast-YDR444W , yeast-yfd4

Title : Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae - Li_2007_J.Proteome.Res_6_1190
Author(s) : Li X , Gerber SA , Rudner AD , Beausoleil SA , Haas W , Villen J , Elias JE , Gygi SP
Ref : J Proteome Res , 6 :1190 , 2007
Abstract : Li_2007_J.Proteome.Res_6_1190
ESTHER : Li_2007_J.Proteome.Res_6_1190
PubMedSearch : Li_2007_J.Proteome.Res_6_1190
PubMedID: 17330950
Gene_locus related to this paper: yeast-YDR428C

Title : Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway - Gruhler_2005_Mol.Cell.Proteomics_4_310
Author(s) : Gruhler A , Olsen JV , Mohammed S , Mortensen P , Faergeman NJ , Mann M , Jensen ON
Ref : Mol Cell Proteomics , 4 :310 , 2005
Abstract : Gruhler_2005_Mol.Cell.Proteomics_4_310
ESTHER : Gruhler_2005_Mol.Cell.Proteomics_4_310
PubMedSearch : Gruhler_2005_Mol.Cell.Proteomics_4_310
PubMedID: 15665377
Gene_locus related to this paper: yeast-YDR428C

Title : Crystal structure of an alpha\/beta serine hydrolase (YDR428C) from Saccharomyces cerevisiae at 1.85 A resolution -
Author(s) : Arndt JW , Schwarzenbacher R , Page R , Abdubek P , Ambing E , Biorac T , Canaves JM , Chiu HJ , Dai X , Deacon AM , DiDonato M , Elsliger MA , Godzik A , Grittini C , Grzechnik SK , Hale J , Hampton E , Han GW , Haugen J , Hornsby M , Klock HE , Koesema E , Kreusch A , Kuhn P , Jaroszewski L , Lesley SA , Levin I , McMullan D , McPhillips TM , Miller MD , Morse A , Moy K , Nigoghossian E , Ouyang J , Peti WS , Quijano K , Reyes R , Sims E , Spraggon G , Stevens RC , van den Bedem H , Velasquez J , Vincent J , von Delft F , Wang X , West B , White A , Wolf G , Xu Q , Zagnitko O , Hodgson KO , Wooley J , Wilson IA
Ref : Proteins , 58 :755 , 2005
PubMedID: 15624212
Gene_locus related to this paper: yeast-YDR428C

Title : Synergistic computational and experimental proteomics approaches for more accurate detection of active serine hydrolases in yeast - Baxter_2004_Mol.Cell.Proteomics_3_209
Author(s) : Baxter SM , Rosenblum JS , Knutson S , Nelson MR , Montimurro JS , Di Gennaro JA , Speir JA , Burbaum JJ , Fetrow JS
Ref : Mol Cell Proteomics , 3 :209 , 2004
Abstract : Baxter_2004_Mol.Cell.Proteomics_3_209
ESTHER : Baxter_2004_Mol.Cell.Proteomics_3_209
PubMedSearch : Baxter_2004_Mol.Cell.Proteomics_3_209
PubMedID: 14645503
Gene_locus related to this paper: yeast-FSH1 , yeast-FSH2 , yeast-FSH3 , yeast-mgll , yeast-ppme1 , yeast-YDR428C , yeast-yfd4 , yeast-YLR118c

Title : The nucleotide sequence of Saccharomyces cerevisiae chromosome IV - Jacq_1997_Nature_387_75
Author(s) : Jacq C , Alt-Morbe J , Andre B , Arnold W , Bahr A , Ballesta JP , Bargues M , Baron L , Becker A , Biteau N , Blocker H , Blugeon C , Boskovic J , Brandt P , Bruckner M , Buitrago MJ , Coster F , Delaveau T , del Rey F , Dujon B , Eide LG , Garcia-Cantalejo JM , Goffeau A , Gomez-Peris AC , Granotier C , Hanemann V , Hankeln T , Hoheisel JD , Jager W , Jimenez A , Jonniaux JL , Kramer C , Kuster H , Laamanen P , Legros Y , Louis E , Muller-Rieker S , Monnet A , Moro M , Muller-Auer S , Nussbaumer B , Paricio N , Paulin L , Perea J , Perez-Alonso M , Perez-Ortin JE , Pohl TM , Prydz H , Purnelle B , Rasmussen SW , Remacha M , Revuelta JL , Rieger M , Salom D , Saluz HP , Saiz JE , Saren AM , Schafer M , Scharfe M , Schmidt ER , Schneider C , Scholler P , Schwarz S , Soler-Mira A , Urrestarazu LA , Verhasselt P , Vissers S , Voet M , Volckaert G , Wagner G , Wambutt R , Wedler E , Wedler H , Wolfl S , Harris DE , Bowman S , Brown D , Churcher CM , Connor R , Dedman K , Gentles S , Hamlin N , Hunt S , Jones L , McDonald S , Murphy L , Niblett D , Odell C , Oliver K , Rajandream MA , Richards C , Shore L , Walsh SV , Barrell BG , Dietrich FS , Mulligan J , Allen E , Araujo R , Aviles E , Berno A , Carpenter J , Chen E , Cherry JM , Chung E , Duncan M , Hunicke-Smith S , Hyman R , Komp C , Lashkari D , Lew H , Lin D , Mosedale D , Nakahara K , Namath A , Oefner P , Oh C , Petel FX , Roberts D , Schramm S , Schroeder M , Shogren T , Shroff N , Winant A , Yelton M , Botstein D , Davis RW , Johnston M , Hillier L , Riles L , Albermann K , Hani J , Heumann K , Kleine K , Mewes HW , Zollner A , Zaccaria P
Ref : Nature , 387 :75 , 1997
Abstract : Jacq_1997_Nature_387_75
ESTHER : Jacq_1997_Nature_387_75
PubMedSearch : Jacq_1997_Nature_387_75
PubMedID: 9169867
Gene_locus related to this paper: yeast-dlhh , yeast-ECM18 , yeast-YDL109C , yeast-YDR428C , yeast-YDR444W