arath-q9lhe8

Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MZE19 (At3g19970/MZE19_2)

Comment

Relationship

Family : Duf_829

Block : X

Position in NCBI Life Tree : Arabidopsis thaliana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGSLSGIIQRPLVAAAAVITASVSADVSERFSSLRSLVRG
SESEQIAPSV SGLVQEERSLWVSQVSASKLADLSFVSRI
CVPVPNVDLLASNPSCSLATS VTSLSALRSVYQSAELAK
ASKPVAFTIGASLVVPDISYRWHLPEPSAVDM SGSSSCV
SEKNRTVVVLLGWLGSKQKHLKKYADWYTSKGYHVITFTL
PMN EIMSYQVGGKAEKNIESLVNHLADWLDEEQKKNLVF
HTFSNTGWLTYGAI LEKFQKQDSSLMGRVKGCIVDSAPV
AAADPTVWASGFSAAFLKKSSVATK GSASSSYESNGINI
SQPKPAATETALLLVLEKFFAVILNLPKVNRRLADV LDT
LSTAQPSCPQLYIYSSADRVIPVEQVESFIVEQRKAGHEV
RACNFIS SPHVDHFRSNPELYTAELNHFMNNFVLSCCHH
SS

References

Title : The Arabidopsis lyrata genome sequence and the basis of rapid genome size change - Hu_2011_Nat.Genet_43_476
Author(s) : Hu TT , Pattyn P , Bakker EG , Cao J , Cheng JF , Clark RM , Fahlgren N , Fawcett JA , Grimwood J , Gundlach H , Haberer G , Hollister JD , Ossowski S , Ottilar RP , Salamov AA , Schneeberger K , Spannagl M , Wang X , Yang L , Nasrallah ME , Bergelson J , Carrington JC , Gaut BS , Schmutz J , Mayer KF , Van de Peer Y , Grigoriev IV , Nordborg M , Weigel D , Guo YL
Ref : Nat Genet , 43 :476 , 2011
Abstract : Hu_2011_Nat.Genet_43_476
ESTHER : Hu_2011_Nat.Genet_43_476
PubMedSearch : Hu_2011_Nat.Genet_43_476
PubMedID: 21478890
Gene_locus related to this paper: arall-d7kc59 , arall-d7kfz1 , arall-d7kjk9 , arall-d7kk58 , arall-d7kuj1 , arall-d7kwx5 , arall-d7kzq8 , arall-d7laf7 , arall-D7LAK6 , arall-d7ltj2 , arall-d7lu11 , arall-d7ly06 , arall-d7lyn6 , arall-d7m1k0 , arall-d7m1k1 , arall-d7m1k3 , arall-d7m1l4 , arall-d7m814 , arall-d7mbk0 , arall-d7mbn8 , arall-d7mgs1 , arall-d7mi04 , arall-d7mld7 , arall-d7mpg7 , arall-d7mul9 , arath-At2g45610 , arath-At1g05790 , arath-At1g09980 , arath-At1g18360 , arath-AT1G29120 , arath-AT1G73920 , arath-AT1G76140 , arath-AT2G05260 , arath-At2g15230 , arath-At2g24280 , arath-AT2G42690 , arath-At2g47630 , arath-AT3G12150 , arath-At3g61680 , arath-AT3g62590 , arath-AT4G00500 , arath-AT4G25770 , arath-AT4g30610 , arath-At5g11650 , arath-At5g13640 , arath-AT5G19050 , arath-AT5G20060 , arath-AT5G20520 , arath-AT5G27320 , arath-At5g42930 , arath-At5g47330 , arath-CGEP , arath-clh1 , arath-clh2 , arath-F1N13.220 , arath-F2G14.100 , arath-F12A4.4 , arath-F14O10.2 , arath-SCP27 , arath-HNL , arath-GID1B , arath-LIP2 , arath-At5g17670 , arath-pip , arath-PLA11 , arath-PLA12 , arath-PLA13 , arath-PLA15 , arath-PLA17 , arath-Q8LPF5 , arath-Q9FFZ1 , arath-Q9FJ29 , arath-Q9FKP9 , arath-Q9FNF6 , arath-q9lhe8 , arath-Q9SFF6 , arath-q84w08 , arath-SCP7 , arath-SCP8 , arath-SCP26 , arath-SCP28 , arath-SCP33 , arath-SCP40 , arath-SCPL34 , arath-At4g12230 , arath-MES14 , arath-T19F11.2 , arath-MES10 , arath-At5g11790 , arath-T26B15.8 , arath-ZW18 , arall-d7l971 , arall-d7lfd3 , arall-d7lg04 , arall-d7lg05 , arall-d7lg06 , arall-d7lg07 , arall-d7mb17 , arall-d7mb18 , arall-d7l7v2 , arall-d7l7v3 , arall-d7lst0 , arall-d7lfw9 , arall-d7mgs6 , arall-d7mur3 , arall-d7kjr5 , arall-d7l7v1 , arall-d7ls88 , arall-d7kzg6 , arall-d7kcm6 , arall-d7krm0 , arall-d7kwe4 , arall-d7lri7 , arall-d7kq26

Title : Structural analysis of Arabidopsis thaliana chromosome 3. II. Sequence features of the 4,251,695 bp regions covered by 90 P1, TAC and BAC clones - Kaneko_2000_DNA.Res_7_217
Author(s) : Kaneko T , Katoh T , Sato S , Nakamura A , Asamizu E , Tabata S
Ref : DNA Research , 7 :217 , 2000
Abstract : Kaneko_2000_DNA.Res_7_217
ESTHER : Kaneko_2000_DNA.Res_7_217
PubMedSearch : Kaneko_2000_DNA.Res_7_217
PubMedID: 10907853
Gene_locus related to this paper: arath-SCP16 , arath-CXE11 , arath-q9lhe8 , arath-Q9LJI1 , arath-Q9LK01 , arath-SCP15