arath-HNL

Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) HNL F18D22_70 at5g10300 alpha-hydroxynitrile lyase-like AtHNL MES5

Comment

"Other strains: Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)"

Relationship

Family : Hydroxynitrile_lyase

Block : X

Position in NCBI Life Tree : Arabidopsis thaliana

Molecular evidence

No mutation

No kinetic

No disease

No inhibitor

Database

Sequence

Peptide

MERKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELA
ASGIDPRPIQ AVETVDEYSKPLIETLKSLPENEEVILVG
FSFGGINIALAADIFPAKIKV LVFLNAFLPDTTHVPSHV
LDKYMEMPGGLGDCEFSSHETRNGTMSLLKMG PKFMKAR
LYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGS
VQR VYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDH
MVMLSKPQKLFDSL SAIATDYM

References

Title : Hydroxynitrile lyase engineering for promiscuous asymmetric Henry reaction with enhanced conversion, enantioselectivity and catalytic efficiency - Priya_2023_Chem.Commun.(Camb)_59_12274
Author(s) : Priya BV , Rao DHS , Chatterjee A , Padhi SK
Ref : Chem Commun (Camb) , 59 :12274 , 2023
Abstract : Priya_2023_Chem.Commun.(Camb)_59_12274
ESTHER : Priya_2023_Chem.Commun.(Camb)_59_12274
PubMedSearch : Priya_2023_Chem.Commun.(Camb)_59_12274
PubMedID: 37750925
Gene_locus related to this paper: arath-HNL

Title : Catalytically active inclusion bodies (CatIBs) induced by terminally attached self-assembling coiled-coil domains: To enhance the stability of (R)-hydroxynitrile lyase - Pei_2022_Enzyme.Microb.Technol_153_109915
Author(s) : Pei X , Wang J , Zheng H , Xiao Q , Wang A , Su W
Ref : Enzyme Microb Technol , 153 :109915 , 2022
Abstract : Pei_2022_Enzyme.Microb.Technol_153_109915
ESTHER : Pei_2022_Enzyme.Microb.Technol_153_109915
PubMedSearch : Pei_2022_Enzyme.Microb.Technol_153_109915
PubMedID: 34670185
Gene_locus related to this paper: arath-HNL

Title : Enzyme engineering improves catalytic efficiency and enantioselectivity of hydroxynitrile lyase for promiscuous retro-nitroaldolase activity - Vishnu_2022_Bioorg.Chem_120_105594
Author(s) : Vishnu Priya B , Sreenivasa Rao DH , Gilani R , Lata S , Rai N , Akif M , Kumar Padhi S
Ref : Bioorg Chem , 120 :105594 , 2022
Abstract : Vishnu_2022_Bioorg.Chem_120_105594
ESTHER : Vishnu_2022_Bioorg.Chem_120_105594
PubMedSearch : Vishnu_2022_Bioorg.Chem_120_105594
PubMedID: 35007952
Gene_locus related to this paper: arath-HNL

Title : Hydroxynitrile lyase defends Arabidopsis against Tetranychus urticae - Arnaiz_2022_Plant.Physiol_189_2244
Author(s) : Arnaiz A , Santamaria ME , Rosa-Diaz I , Garcia I , Dixit S , Vallejos S , Gotor C , Martinez M , Grbic V , Diaz I
Ref : Plant Physiol , 189 :2244 , 2022
Abstract : Arnaiz_2022_Plant.Physiol_189_2244
ESTHER : Arnaiz_2022_Plant.Physiol_189_2244
PubMedSearch : Arnaiz_2022_Plant.Physiol_189_2244
PubMedID: 35474139
Gene_locus related to this paper: arath-HNL

Title : Immobilized Arabidopsis thaliana Hydroxynitrile Lyase-Catalyzed Retro-Henry Reaction in the Synthesis of (S)-beta-Nitroalcohols - Rao_2021_Appl.Biochem.Biotechnol_193_560
Author(s) : Rao DHS , Shivani K , Padhi SK
Ref : Appl Biochem Biotechnol , 193 :560 , 2021
Abstract : Rao_2021_Appl.Biochem.Biotechnol_193_560
ESTHER : Rao_2021_Appl.Biochem.Biotechnol_193_560
PubMedSearch : Rao_2021_Appl.Biochem.Biotechnol_193_560
PubMedID: 33044692
Gene_locus related to this paper: arath-HNL

Title : Synthesis of (R)-mandelic acid and (R)-mandelic acid amide by recombinant E. coli strains expressing a (R)-specific oxynitrilase and an arylacetonitrilase - Muller_2021_Biotechnol.Lett_43_287
Author(s) : Muller E , Sosedov O , Groning JAD , Stolz A
Ref : Biotechnol Lett , 43 :287 , 2021
Abstract : Muller_2021_Biotechnol.Lett_43_287
ESTHER : Muller_2021_Biotechnol.Lett_43_287
PubMedSearch : Muller_2021_Biotechnol.Lett_43_287
PubMedID: 32936375
Gene_locus related to this paper: arath-HNL

Title : The first enzyme-promoted addition of nitromethane to imines (aza-Henry reaction) - Janicki_2020_Bioorg.Chem_94_103377
Author(s) : Janicki I , Lyzwa P , Kielbasinski P
Ref : Bioorg Chem , 94 :103377 , 2020
Abstract : Janicki_2020_Bioorg.Chem_94_103377
ESTHER : Janicki_2020_Bioorg.Chem_94_103377
PubMedSearch : Janicki_2020_Bioorg.Chem_94_103377
PubMedID: 31662211
Gene_locus related to this paper: arath-HNL

Title : Plant Defenses Against Pests Driven by a Bidirectional Promoter - Arnaiz_2019_Front.Plant.Sci_10_930
Author(s) : Arnaiz A , Martinez M , Gonzalez-Melendi P , Grbic V , Diaz I , Santamaria ME
Ref : Front Plant Sci , 10 :930 , 2019
Abstract : Arnaiz_2019_Front.Plant.Sci_10_930
ESTHER : Arnaiz_2019_Front.Plant.Sci_10_930
PubMedSearch : Arnaiz_2019_Front.Plant.Sci_10_930
PubMedID: 31379907
Gene_locus related to this paper: arath-HNL

Title : Production of (S)-beta-Nitro Alcohols by Enantioselective C-C Bond Cleavage with an R-Selective Hydroxynitrile Lyase - Rao_2019_Chembiochem_20_371
Author(s) : Rao DHS , Padhi SK
Ref : Chembiochem , 20 :371 , 2019
Abstract : Rao_2019_Chembiochem_20_371
ESTHER : Rao_2019_Chembiochem_20_371
PubMedSearch : Rao_2019_Chembiochem_20_371
PubMedID: 30411458
Gene_locus related to this paper: arath-HNL

Title : Identical active sites in hydroxynitrile lyases show opposite enantioselectivity and reveal possible ancestral mechanism - Jones_2017_ACS.Catal_7_4221
Author(s) : Jones BJ , Bata Z , Kazlauskas RJ
Ref : ACS Catal , 7 :4221 , 2017
Abstract : Jones_2017_ACS.Catal_7_4221
ESTHER : Jones_2017_ACS.Catal_7_4221
PubMedSearch : Jones_2017_ACS.Catal_7_4221
PubMedID: 28798888
Gene_locus related to this paper: arath-HNL , hevbr-hnl

Title : Purification and simultaneous immobilization of Arabidopsis thaliana hydroxynitrile lyase using a family 2 carbohydrate-binding module - Kopka_2015_Biotechnol.J_10_811
Author(s) : Kopka B , Diener M , Wirtz A , Pohl M , Jaeger KE , Krauss U
Ref : Biotechnol J , 10 :811 , 2015
Abstract : Kopka_2015_Biotechnol.J_10_811
ESTHER : Kopka_2015_Biotechnol.J_10_811
PubMedSearch : Kopka_2015_Biotechnol.J_10_811
PubMedID: 25755120
Gene_locus related to this paper: arath-HNL

Title : A QM\/MM study of the reaction mechanism of (R)-hydroxynitrile lyases from Arabidopsis thaliana (AtHNL) - Zhu_2015_Proteins_83_66
Author(s) : Zhu W , Liu Y , Zhang R
Ref : Proteins , 83 :66 , 2015
Abstract : Zhu_2015_Proteins_83_66
ESTHER : Zhu_2015_Proteins_83_66
PubMedSearch : Zhu_2015_Proteins_83_66
PubMedID: 25052541
Gene_locus related to this paper: arath-HNL

Title : Fusion of a flavin-based fluorescent protein to hydroxynitrile lyase from Arabidopsis thaliana improves enzyme stability - Scholz_2013_Appl.Environ.Microbiol_79_4727
Author(s) : Scholz KE , Kopka B , Wirtz A , Pohl M , Jaeger KE , Krauss U
Ref : Applied Environmental Microbiology , 79 :4727 , 2013
Abstract : Scholz_2013_Appl.Environ.Microbiol_79_4727
ESTHER : Scholz_2013_Appl.Environ.Microbiol_79_4727
PubMedSearch : Scholz_2013_Appl.Environ.Microbiol_79_4727
PubMedID: 23728815
Gene_locus related to this paper: arath-HNL

Title : Synthesis of chiral cyanohydrins by recombinant Escherichia coli cells in a micro-aqueous reaction system - Scholz_2012_Appl.Environ.Microbiol_78_5025
Author(s) : Scholz KE , Okrob D , Kopka B , Grunberger A , Pohl M , Jaeger KE , Krauss U
Ref : Applied Environmental Microbiology , 78 :5025 , 2012
Abstract : Scholz_2012_Appl.Environ.Microbiol_78_5025
ESTHER : Scholz_2012_Appl.Environ.Microbiol_78_5025
PubMedSearch : Scholz_2012_Appl.Environ.Microbiol_78_5025
PubMedID: 22544258
Gene_locus related to this paper: arath-HNL

Title : Tailoring a stabilized variant of hydroxynitrile lyase from Arabidopsis thaliana - Okrob_2012_Chembiochem_13_797
Author(s) : Okrob D , Metzner J , Wiechert W , Gruber K , Pohl M
Ref : Chembiochem , 13 :797 , 2012
Abstract : Okrob_2012_Chembiochem_13_797
ESTHER : Okrob_2012_Chembiochem_13_797
PubMedSearch : Okrob_2012_Chembiochem_13_797
PubMedID: 22378361
Gene_locus related to this paper: arath-HNL

Title : Hydroxynitrile lyases with alpha\/beta-hydrolase fold: two enzymes with almost identical 3D structures but opposite enantioselectivities and different reaction mechanisms - Andexer_2012_Chembiochem_13_1932
Author(s) : Andexer JN , Staunig N , Eggert T , Kratky C , Pohl M , Gruber K
Ref : Chembiochem , 13 :1932 , 2012
Abstract : Andexer_2012_Chembiochem_13_1932
ESTHER : Andexer_2012_Chembiochem_13_1932
PubMedSearch : Andexer_2012_Chembiochem_13_1932
PubMedID: 22851196
Gene_locus related to this paper: arath-HNL

Title : Synthesis of (R)-beta-nitro alcohols catalyzed by R-selective hydroxynitrile lyase from Arabidopsis thaliana in the aqueous-organic biphasic system - Fuhshuku_2011_J.Biotechnol_153_153
Author(s) : Fuhshuku K , Asano Y
Ref : J Biotechnol , 153 :153 , 2011
Abstract : Fuhshuku_2011_J.Biotechnol_153_153
ESTHER : Fuhshuku_2011_J.Biotechnol_153_153
PubMedSearch : Fuhshuku_2011_J.Biotechnol_153_153
PubMedID: 21439333
Gene_locus related to this paper: arath-HNL

Title : The Arabidopsis lyrata genome sequence and the basis of rapid genome size change - Hu_2011_Nat.Genet_43_476
Author(s) : Hu TT , Pattyn P , Bakker EG , Cao J , Cheng JF , Clark RM , Fahlgren N , Fawcett JA , Grimwood J , Gundlach H , Haberer G , Hollister JD , Ossowski S , Ottilar RP , Salamov AA , Schneeberger K , Spannagl M , Wang X , Yang L , Nasrallah ME , Bergelson J , Carrington JC , Gaut BS , Schmutz J , Mayer KF , Van de Peer Y , Grigoriev IV , Nordborg M , Weigel D , Guo YL
Ref : Nat Genet , 43 :476 , 2011
Abstract : Hu_2011_Nat.Genet_43_476
ESTHER : Hu_2011_Nat.Genet_43_476
PubMedSearch : Hu_2011_Nat.Genet_43_476
PubMedID: 21478890
Gene_locus related to this paper: arall-d7kc59 , arall-d7kfz1 , arall-d7kjk9 , arall-d7kk58 , arall-d7kuj1 , arall-d7kwx5 , arall-d7kzq8 , arall-d7laf7 , arall-D7LAK6 , arall-d7ltj2 , arall-d7lu11 , arall-d7ly06 , arall-d7lyn6 , arall-d7m1k0 , arall-d7m1k1 , arall-d7m1k3 , arall-d7m1l4 , arall-d7m814 , arall-d7mbk0 , arall-d7mbn8 , arall-d7mgs1 , arall-d7mi04 , arall-d7mld7 , arall-d7mpg7 , arall-d7mul9 , arath-At2g45610 , arath-At1g05790 , arath-At1g09980 , arath-At1g18360 , arath-AT1G29120 , arath-AT1G73920 , arath-AT1G76140 , arath-AT2G05260 , arath-At2g15230 , arath-At2g24280 , arath-AT2G42690 , arath-At2g47630 , arath-AT3G12150 , arath-At3g61680 , arath-AT3g62590 , arath-AT4G00500 , arath-AT4G25770 , arath-AT4g30610 , arath-At5g11650 , arath-At5g13640 , arath-AT5G19050 , arath-AT5G20060 , arath-AT5G20520 , arath-AT5G27320 , arath-At5g42930 , arath-At5g47330 , arath-CGEP , arath-clh1 , arath-clh2 , arath-F1N13.220 , arath-F2G14.100 , arath-F12A4.4 , arath-F14O10.2 , arath-SCP27 , arath-HNL , arath-GID1B , arath-LIP2 , arath-At5g17670 , arath-pip , arath-PLA11 , arath-PLA12 , arath-PLA13 , arath-PLA15 , arath-PLA17 , arath-Q8LPF5 , arath-Q9FFZ1 , arath-Q9FJ29 , arath-Q9FKP9 , arath-Q9FNF6 , arath-q9lhe8 , arath-Q9SFF6 , arath-q84w08 , arath-SCP7 , arath-SCP8 , arath-SCP26 , arath-SCP28 , arath-SCP33 , arath-SCP40 , arath-SCPL34 , arath-At4g12230 , arath-MES14 , arath-T19F11.2 , arath-MES10 , arath-At5g11790 , arath-T26B15.8 , arath-ZW18 , arall-d7l971 , arall-d7lfd3 , arall-d7lg04 , arall-d7lg05 , arall-d7lg06 , arall-d7lg07 , arall-d7mb17 , arall-d7mb18 , arall-d7l7v2 , arall-d7l7v3 , arall-d7lst0 , arall-d7lfw9 , arall-d7mgs6 , arall-d7mur3 , arall-d7kjr5 , arall-d7l7v1 , arall-d7ls88 , arall-d7kzg6 , arall-d7kcm6 , arall-d7krm0 , arall-d7kwe4 , arall-d7lri7 , arall-d7kq26

Title : Uneven twins: comparison of two enantiocomplementary hydroxynitrile lyases with alpha\/beta-hydrolase fold - Guterl_2009_J.Biotechnol_141_166
Author(s) : Guterl JK , Andexer JN , Sehl T , von Langermann J , Frindi-Wosch I , Rosenkranz T , Fitter J , Gruber K , Kragl U , Eggert T , Pohl M
Ref : J Biotechnol , 141 :166 , 2009
Abstract : Guterl_2009_J.Biotechnol_141_166
ESTHER : Guterl_2009_J.Biotechnol_141_166
PubMedSearch : Guterl_2009_J.Biotechnol_141_166
PubMedID: 19433222
Gene_locus related to this paper: arath-HNL , hevbr-hnl , manes-hnl

Title : An R-selective hydroxynitrile lyase from Arabidopsis thaliana with an alpha\/beta-hydrolase fold -
Author(s) : Andexer J , von Langermann J , Mell A , Bocola M , Kragl U , Eggert T , Pohl M
Ref : Angew Chem Int Ed Engl , 46 :8679 , 2007
PubMedID: 17907254
Gene_locus related to this paper: arath-HNL

Title : Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones. -
Author(s) : Asamizu E , Sato S , Kaneko T , Nakamura Y , Kotani H , Miyajima N , Tabata S
Ref : DNA Research , 5 :379 , 1998
PubMedID: 10048488
Gene_locus related to this paper: arath-At5g14930 , arath-at5g18630 , arath-AT5G19050 , arath-At5g24180 , arath-AT5G24190 , arath-At5g24200 , arath-F2G14.100 , arath-F6H11.120 , arath-F9G14.280 , arath-F14F8.240 , arath-HNL , arath-At5g14310