aspna-g3ycq2

Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Carboxylesterase

Comment

"A carboxylesterase of strain ATCC 1015 not in strain CBS 513.88 \/ FGSC A1513)"

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Aspergillus niger

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MPATGSLVLRGLAALALTVVSAQAQLWNQTIQTSYGPVKG
FQYFDQTTLE TYFNVSESNVTAFLGIPYAADTSYGNRWK
PPQPRQSWNKTFDAVEFGYTC PTAMSSNSSEDCLNLNIW
TNAGSPDARLPVMVWNQGSDLSSDIPYWYGGG MALKDVI
LVSFNRRDDAFGYLAHPELNKEGFEETGHYTSGNYGILDF
LEV LKWVQANIANFGGNPDRVVIAGQSFGSSQVYHAVNS
PLFSGLFHGAISES GIRYPYDPMLAGLATSYNNMSAALA
HGLNYTSFHNVSSIAELRTLSTADL MQGSTDKVNNTWIN
WVTALSCGYPDIFKPVLDDYVLPSTYLQTLRNGPAN DVP
LITGNTKDESGASTTTNYTLGEYRTYNTLRYGNLTSNYFS
LYPDHNN QTIANEAWNDAARDQSKVGSWAYATQWYGAAK
ADFYTYYWTHAPPGQTEG AFHMSEIMYALNALYSCADLY
SFTAEDYAIADKLSAYWANFAKTLDPNIG DSYTGSDGPL
AHWEPNSPKGKPAVVMELGDAFREIEVAGPEKVEFVMEYF
AQQTPY

References

Title : Comparative genomics of citric-acid-producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88 - Andersen_2011_Genome.Res_21_885
Author(s) : Andersen MR , Salazar MP , Schaap PJ , van de Vondervoort PJ , Culley D , Thykaer J , Frisvad JC , Nielsen KF , Albang R , Albermann K , Berka RM , Braus GH , Braus-Stromeyer SA , Corrochano LM , Dai Z , van Dijck PW , Hofmann G , Lasure LL , Magnuson JK , Menke H , Meijer M , Meijer SL , Nielsen JB , Nielsen ML , van Ooyen AJ , Pel HJ , Poulsen L , Samson RA , Stam H , Tsang A , van den Brink JM , Atkins A , Aerts A , Shapiro H , Pangilinan J , Salamov A , Lou Y , Lindquist E , Lucas S , Grimwood J , Grigoriev IV , Kubicek CP , Martinez D , van Peij NN , Roubos JA , Nielsen J , Baker SE
Ref : Genome Res , 21 :885 , 2011
Abstract : Andersen_2011_Genome.Res_21_885
ESTHER : Andersen_2011_Genome.Res_21_885
PubMedSearch : Andersen_2011_Genome.Res_21_885
PubMedID: 21543515
Gene_locus related to this paper: aspna-g3y4g9 , aspna-g3yal2 , aspna-g3ycq2 , aspnc-a2qbh3 , aspnc-a2qe77 , aspnc-a2qf54 , aspnc-a2qfe9 , aspnc-a2qg33 , aspnc-a2qh76 , aspnc-a2qhe2 , aspnc-a2qi32 , aspnc-a2ql89 , aspnc-a2ql90 , aspnc-a2qla0 , aspnc-a2qmk5 , aspnc-a2qn56 , aspnc-a2qs22 , aspnc-a2qti9 , aspnc-a2qtz0 , aspnc-a2quc1 , aspnc-a2qx92 , aspnc-a2qyf0 , aspnc-a2qys7 , aspnc-a2qz72 , aspnc-a2qzn6 , aspnc-a2qzr0 , aspnc-a2qzx0 , aspnc-a2qzx4 , aspnc-a2r0p4 , aspnc-a2r1r5 , aspnc-a2r2i5 , aspnc-a2r5r4 , aspnc-a2r6h5 , aspnc-a2r8r3 , aspnc-a2r8z3 , aspnc-a2r273 , aspnc-a2r496 , aspnc-a2r502 , aspnc-a5abe5 , aspnc-a5abe8 , aspnc-a5abh9 , aspnc-a5abk1 , aspnc-axe1 , aspnc-cuti1 , aspnc-cuti2 , aspng-a2qs46 , aspng-a2qv27 , aspni-EstA , aspkw-g7y0v7 , aspnc-a2qt47 , aspnc-a2qt66 , aspna-g3xpq9 , aspnc-a2qqa1 , aspna-g3xsl3 , aspna-g3y5a6 , aspna-g3xpw9 , aspaw-a0a401kpx5 , aspnc-a2qw57 , aspaw-a0a401kcz4 , aspna-alba , aspna-azac