aspna-alba

Aspergillus niger. Non-reducing polyketide synthase albA. Thioesterase last domain

Comment

"Other strains: Aspergillus niger (strains: ATCC 1015 \/ CBS 113.46 \/ FGSC A1144 \/ LSHB Ac4 \/ NCTC 3858a \/ NRRL 328 \/ USDA 3528.7\; CBS 513.88 \/ FGSC A1513)"

Relationship

Family : Thioesterase

Block : X

Position in NCBI Life Tree : Aspergillus niger

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

GVDSLLSLTVTGRYREELDIDLESSIFIDQPTVKDFKQFL
APMSQGEASD GSTSDPESSSSFNGGSSTDESSAGSPVSS
PPNEKVTQVEQHATIKEIRAI LADEIGVTEEELKDDENL
GEMGMDSLLSLTVLGRIRETLDLDLPGEFFIE NQTLNDV
EDALGLKPKAAPAPAPAPAPVPAPVSAPILKEPVPNANST
IMA RASPHPRSTSILLQGNPKTATKTLFLFPDGSGSATS
YATIPGVSPDVCVY GLNCPYMKTPEKLKYPLAEMTFPYL
AEIRRRQPKGPYNFGGWSAGGICAY DAARYLILEEGEQV
DRLLLLDSPFPIGLEKLPTRLYGFINSMGLFGEGNK APP
AWLLPHFLAFIDSLDTYKAVPLPFDDPKWAKKMPKTFMVW
AKDGICS KPDDPWPEPDPDGKPDTREMVWLLKNRTDMGP
NKWDTLVGPQNVGGITVI EGANHFTMTLGPKAKELGSFI
GNAMAN

References

Title : Biaryl-Forming Enzymes from Aspergilli Exhibit Substrate-Dependent Stereoselectivity - Obermaier_2019_Biochemistry_58_2589
Author(s) : Obermaier S , Muller M
Ref : Biochemistry , 58 :2589 , 2019
Abstract : Obermaier_2019_Biochemistry_58_2589
ESTHER : Obermaier_2019_Biochemistry_58_2589
PubMedSearch : Obermaier_2019_Biochemistry_58_2589
PubMedID: 31067027
Gene_locus related to this paper: aspna-alba , aspbc-alba

Title : Comparative genomics of citric-acid-producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88 - Andersen_2011_Genome.Res_21_885
Author(s) : Andersen MR , Salazar MP , Schaap PJ , van de Vondervoort PJ , Culley D , Thykaer J , Frisvad JC , Nielsen KF , Albang R , Albermann K , Berka RM , Braus GH , Braus-Stromeyer SA , Corrochano LM , Dai Z , van Dijck PW , Hofmann G , Lasure LL , Magnuson JK , Menke H , Meijer M , Meijer SL , Nielsen JB , Nielsen ML , van Ooyen AJ , Pel HJ , Poulsen L , Samson RA , Stam H , Tsang A , van den Brink JM , Atkins A , Aerts A , Shapiro H , Pangilinan J , Salamov A , Lou Y , Lindquist E , Lucas S , Grimwood J , Grigoriev IV , Kubicek CP , Martinez D , van Peij NN , Roubos JA , Nielsen J , Baker SE
Ref : Genome Res , 21 :885 , 2011
Abstract : Andersen_2011_Genome.Res_21_885
ESTHER : Andersen_2011_Genome.Res_21_885
PubMedSearch : Andersen_2011_Genome.Res_21_885
PubMedID: 21543515
Gene_locus related to this paper: aspna-g3y4g9 , aspna-g3yal2 , aspna-g3ycq2 , aspnc-a2qbh3 , aspnc-a2qe77 , aspnc-a2qf54 , aspnc-a2qfe9 , aspnc-a2qg33 , aspnc-a2qh76 , aspnc-a2qhe2 , aspnc-a2qi32 , aspnc-a2ql89 , aspnc-a2ql90 , aspnc-a2qla0 , aspnc-a2qmk5 , aspnc-a2qn56 , aspnc-a2qs22 , aspnc-a2qti9 , aspnc-a2qtz0 , aspnc-a2quc1 , aspnc-a2qx92 , aspnc-a2qyf0 , aspnc-a2qys7 , aspnc-a2qz72 , aspnc-a2qzn6 , aspnc-a2qzr0 , aspnc-a2qzx0 , aspnc-a2qzx4 , aspnc-a2r0p4 , aspnc-a2r1r5 , aspnc-a2r2i5 , aspnc-a2r5r4 , aspnc-a2r6h5 , aspnc-a2r8r3 , aspnc-a2r8z3 , aspnc-a2r273 , aspnc-a2r496 , aspnc-a2r502 , aspnc-a5abe5 , aspnc-a5abe8 , aspnc-a5abh9 , aspnc-a5abk1 , aspnc-axe1 , aspnc-cuti1 , aspnc-cuti2 , aspng-a2qs46 , aspng-a2qv27 , aspni-EstA , aspkw-g7y0v7 , aspnc-a2qt47 , aspnc-a2qt66 , aspna-g3xpq9 , aspnc-a2qqa1 , aspna-g3xsl3 , aspna-g3y5a6 , aspna-g3xpw9 , aspaw-a0a401kpx5 , aspnc-a2qw57 , aspaw-a0a401kcz4 , aspna-alba , aspna-azac

Title : Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88 - Pel_2007_Nat.Biotechnol_25_221
Author(s) : Pel HJ , de Winde JH , Archer DB , Dyer PS , Hofmann G , Schaap PJ , Turner G , de Vries RP , Albang R , Albermann K , Andersen MR , Bendtsen JD , Benen JA , van den Berg M , Breestraat S , Caddick MX , Contreras R , Cornell M , Coutinho PM , Danchin EG , Debets AJ , Dekker P , van Dijck PW , van Dijk A , Dijkhuizen L , Driessen AJ , d'Enfert C , Geysens S , Goosen C , Groot GS , de Groot PW , Guillemette T , Henrissat B , Herweijer M , van den Hombergh JP , van den Hondel CA , van der Heijden RT , van der Kaaij RM , Klis FM , Kools HJ , Kubicek CP , van Kuyk PA , Lauber J , Lu X , van der Maarel MJ , Meulenberg R , Menke H , Mortimer MA , Nielsen J , Oliver SG , Olsthoorn M , Pal K , van Peij NN , Ram AF , Rinas U , Roubos JA , Sagt CM , Schmoll M , Sun J , Ussery D , Varga J , Vervecken W , van de Vondervoort PJ , Wedler H , Wosten HA , Zeng AP , van Ooyen AJ , Visser J , Stam H
Ref : Nat Biotechnol , 25 :221 , 2007
Abstract : Pel_2007_Nat.Biotechnol_25_221
ESTHER : Pel_2007_Nat.Biotechnol_25_221
PubMedSearch : Pel_2007_Nat.Biotechnol_25_221
PubMedID: 17259976
Gene_locus related to this paper: aspna-g3yal2 , aspnc-a2q8r7 , aspnc-a2q814 , aspnc-a2qb93 , aspnc-a2qbd3 , aspnc-a2qbh3 , aspnc-a2qbx7 , aspnc-a2qdj6 , aspnc-a2qe77 , aspnc-a2qf54 , aspnc-a2qfe9 , aspnc-a2qg33 , aspnc-a2qgj6 , aspnc-a2qgm6 , aspnc-a2qh52 , aspnc-a2qh76 , aspnc-a2qh85 , aspnc-a2qhe2 , aspnc-a2qi32 , aspnc-a2qib2 , aspnc-a2qk14 , aspnc-a2ql23 , aspnc-a2ql89 , aspnc-a2ql90 , aspnc-a2qla0 , aspnc-a2qlz0 , aspnc-a2qm14 , aspnc-a2qmk5 , aspnc-a2qms0 , aspnc-a2qn29 , aspnc-a2qn56 , aspnc-a2qn70 , aspnc-a2qnw9 , aspnc-a2qr21 , aspnc-a2qs22 , aspnc-a2qt50 , aspnc-a2qti9 , aspnc-a2qtz0 , aspnc-a2quc1 , aspnc-a2qw06 , aspnc-a2qwz6 , aspnc-a2qx92 , aspnc-a2qyf0 , aspnc-a2qys7 , aspnc-a2qz72 , aspnc-a2qzn6 , aspnc-a2qzr0 , aspnc-a2qzs1 , aspnc-a2qzx0 , aspnc-a2qzx4 , aspnc-a2r0p4 , aspnc-a2r0u0 , aspnc-a2r1p3 , aspnc-a2r1r5 , aspnc-a2r2i5 , aspnc-a2r2l0 , aspnc-a2r3s8 , aspnc-a2r4c0 , aspnc-a2r4j8 , aspnc-a2r5r4 , aspnc-a2r6g3 , aspnc-a2r6h5 , aspnc-a2r6h8 , aspnc-a2r7q1 , aspnc-a2r8r3 , aspnc-a2r8z3 , aspnc-a2r9y8 , aspnc-a2r032 , aspnc-a2r040 , aspnc-a2r273 , aspnc-a2r496 , aspnc-a2r502 , aspnc-a2ra07 , aspnc-a2rap4 , aspnc-a2raq2 , aspnc-a2rav1 , aspnc-a5aaf4 , aspnc-a5ab63 , aspnc-a5abc6 , aspnc-a5abe5 , aspnc-a5abe8 , aspnc-a5abf0 , aspnc-a5abh9 , aspnc-a5abk1 , aspnc-a5abt2 , aspnc-a5abz1 , aspnc-atg15 , aspnc-axe1 , aspnc-cuti1 , aspnc-cuti2 , aspnc-faec , aspng-a2q8w0 , aspng-a2qs46 , aspng-a2qst4 , aspng-a2qv27 , aspng-a2qzk9 , aspng-a2r0p8 , aspng-a2r225 , aspng-DAPB , aspng-DPP5 , aspng-faeb , aspni-APSC , aspni-EstA , aspni-FAEA , aspni-PAPA , aspkw-g7y0v7 , aspnc-a2qt47 , aspnc-a2qt66 , aspnc-a2r199 , aspnc-a2r871 , aspnc-a2qbp6 , aspnc-a2qqa1 , aspnc-a2qt70 , aspna-g3y5a6 , aspna-g3xpw9 , aspnc-a2qw57 , aspaw-a0a401kcz4 , aspna-alba , aspnc-kex1 , aspnc-cbpya , aspnc-a2qbg8