emeni-q5ara9

Aspergillus nidulans FGSC A4 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRR 194 / M139) (Aspergillus nidulans) hypothetical protein

Comment

Relationship

Family : Duf_1100-S

Block : X

Position in NCBI Life Tree : Emericella nidulans

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGWILGEKFDTVYPHKGSIEALWETKWKAACEISVYPFHD
GKLEDFEPIF KKLIAENINDAYSDAYTEIFLPFAELLEQ
RAAAALRKGDGATASGLLLRA AVVYRIARFPYVGPATTG
LKRTAFERQKIAYLRAASLWKPQLQETVIGHT HRKGKDG
THIPIYLCVPEDSSKPVPCVLIMTGLDGYRPDNTKRIHEI
VSR GWAVVICEIPGTADSPADPSDPSATDRLLDSVFLYM
RQRTDIDMSRIALW GLSAGGFYAIRAAHTHRNRLAGCIA
HGPGAHYFLSEEWLNRVEDHEYPFP IIRAWAKKYGYDDP
ADFCKNAQQKFSLLETGVLDRPCTRLLLLNGIDDGV VPI
EDCLLLFNHGSPKEGRFYPGLPHMGYPQSLDVAYKWLEDL
LQTGSSS Q

References

Title : The 2008 update of the Aspergillus nidulans genome annotation: a community effort - Wortman_2009_Fungal.Genet.Biol_46 Suppl 1_S2
Author(s) : Wortman JR , Gilsenan JM , Joardar V , Deegan J , Clutterbuck J , Andersen MR , Archer D , Bencina M , Braus G , Coutinho P , von Dohren H , Doonan J , Driessen AJ , Durek P , Espeso E , Fekete E , Flipphi M , Estrada CG , Geysens S , Goldman G , de Groot PW , Hansen K , Harris SD , Heinekamp T , Helmstaedt K , Henrissat B , Hofmann G , Homan T , Horio T , Horiuchi H , James S , Jones M , Karaffa L , Karanyi Z , Kato M , Keller N , Kelly DE , Kiel JA , Kim JM , van der Klei IJ , Klis FM , Kovalchuk A , Krasevec N , Kubicek CP , Liu B , Maccabe A , Meyer V , Mirabito P , Miskei M , Mos M , Mullins J , Nelson DR , Nielsen J , Oakley BR , Osmani SA , Pakula T , Paszewski A , Paulsen I , Pilsyk S , Pocsi I , Punt PJ , Ram AF , Ren Q , Robellet X , Robson G , Seiboth B , van Solingen P , Specht T , Sun J , Taheri-Talesh N , Takeshita N , Ussery D , vanKuyk PA , Visser H , van de Vondervoort PJ , de Vries RP , Walton J , Xiang X , Xiong Y , Zeng AP , Brandt BW , Cornell MJ , van den Hondel CA , Visser J , Oliver SG , Turner G
Ref : Fungal Genet Biol , 46 Suppl 1 :S2 , 2009
Abstract : Wortman_2009_Fungal.Genet.Biol_46 Suppl 1_S2
ESTHER : Wortman_2009_Fungal.Genet.Biol_46 Suppl 1_S2
PubMedSearch : Wortman_2009_Fungal.Genet.Biol_46 Suppl 1_S2
PubMedID: 19146970
Gene_locus related to this paper: emeni-axe1 , emeni-c8v4m7 , emeni-faec , emeni-ppme1 , emeni-q5ara9 , emeni-q5arf0 , emeni-q5as30 , emeni-q5ase8 , emeni-q5av79 , emeni-q5aw09 , emeni-q5awc3 , emeni-q5awc7 , emeni-q5awu9 , emeni-q5aww4 , emeni-q5ax50 , emeni-q5ay37 , emeni-q5ay57 , emeni-q5ay59 , emeni-q5ayk9 , emeni-q5ays5 , emeni-q5az32 , emeni-q5az91 , emeni-q5az97 , emeni-q5azp1 , emeni-q5b0i6 , emeni-q5b1h2 , emeni-q5b2a9 , emeni-q5b2p7 , emeni-q5b3d2 , emeni-q5b4q7 , emeni-q5b5u7 , emeni-q5b5y4 , emeni-q5b9e7 , emeni-q5b9i0 , emeni-q5b364 , emeni-q5b446 , emeni-q5b938 , emeni-q5ba78 , emeni-q5bcd1 , emeni-q5bcd2 , emeni-q5bde7 , emeni-q5bdr0 , emeni-q5bf92 , emeni-q7si80 , emeni-q5bdv9 , emeni-c8vu15 , 9euro-a0a3d8t644 , emeni-q5b719 , emeni-q5ax97 , emeni-tdia , emeni-afoc , emeni-dbae

Title : Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae - Galagan_2005_Nature_438_1105
Author(s) : Galagan JE , Calvo SE , Cuomo C , Ma LJ , Wortman JR , Batzoglou S , Lee SI , Basturkmen M , Spevak CC , Clutterbuck J , Kapitonov V , Jurka J , Scazzocchio C , Farman M , Butler J , Purcell S , Harris S , Braus GH , Draht O , Busch S , d'Enfert C , Bouchier C , Goldman GH , Bell-Pedersen D , Griffiths-Jones S , Doonan JH , Yu J , Vienken K , Pain A , Freitag M , Selker EU , Archer DB , Penalva MA , Oakley BR , Momany M , Tanaka T , Kumagai T , Asai K , Machida M , Nierman WC , Denning DW , Caddick M , Hynes M , Paoletti M , Fischer R , Miller B , Dyer P , Sachs MS , Osmani SA , Birren BW
Ref : Nature , 438 :1105 , 2005
Abstract : Galagan_2005_Nature_438_1105
ESTHER : Galagan_2005_Nature_438_1105
PubMedSearch : Galagan_2005_Nature_438_1105
PubMedID: 16372000
Gene_locus related to this paper: emeni-axe1 , emeni-BST1 , emeni-c8vrl3 , emeni-CUTI3 , emeni-faec , emeni-ppme1 , emeni-q5aqv0 , emeni-q5ara9 , emeni-q5av79 , emeni-q5avd3 , emeni-q5awc7 , emeni-q5awq3 , emeni-q5awu9 , emeni-q5aww7 , emeni-q5ax50 , emeni-q5ay37 , emeni-q5ay57 , emeni-q5ayk9 , emeni-q5az32 , emeni-q5azl2 , emeni-q5azp1 , emeni-q5b1v2 , emeni-q5b2c1 , emeni-q5b3d2 , emeni-q5b5j7 , emeni-q5b7i6 , emeni-q5b8p6 , emeni-q5b9e7 , emeni-q5b246 , emeni-q5b446 , emeni-q5b602 , emeni-q5b938 , emeni-q5ba78 , emeni-q5bad3 , emeni-q5bar0 , emeni-q5bcd1 , emeni-q5bcd2 , emeni-q5bcf8 , emeni-q5bdr0 , emeni-q5beh9 , emeni-q5bgk7 , emeni-q7si80 , emeni-q5bdv9 , emeni-c8vu15 , 9euro-a0a3d8t644 , emeni-q5b719 , emeni-q5ax97 , emeni-tdia , emeni-afoc , emeni-dbae