lactc-c5dnn9

Lachancea thermotolerans (strain CBS 6340) (Yeast) (Kluyveromyces thermotolerans) KLTH0G18656p

Comment

"only central part Pfam A DUF726 441 780"

Relationship

Family : Duf_726

Block : X

Position in NCBI Life Tree : Lachancea thermotolerans

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

LGGSVVLGLSGGLLAPVIGAGIAAGLSTAGITGATGFLTG
VGGTAIVATT STAIGAKIGTQAMSKRMGSVRTFEFSPLH
NNRRVNLIVSVSGWMTGNEDD VRLPFSTVDPVEGDLYSL
HWEPEMLKSTGQTINILASEIFTQTLQQILGA TILTAFM
SAIQMPMMLSKLGYIIDNPWNVSLDRAWAAGLILADTLIS
RNL GQRPVTLIGFSLGARVIYSCLIELCKRNAAGLVENV
FIFGSPVVFNKEEL VMVRSVVSGRFVSGYSEKDWILCYL
FRATGGGFKSVLGISPINGIEGIES FNCTKLVEGHMAYR
KNMPKLLKKMGLSV

References