neucr-B13B3.090

Neurospora crassa related to 3-oxoadipate enol-lactonase I

Comment

"only c-term PfamA Abhydrolase_1 331 550"

Relationship

Family : 6_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Neurospora crassa

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

GPIISSYITTPHDGLVIPYQLEGNPSPSAPVIAFSNSLLT
SLHMWDPLVK LLKASRPDLRILRYDTRGRHSIPSPPQPA
TLDLLADDLASLLDALRINKL QTLVGVSMGGATTLNFAI
RHPSRLQKFVACDFNAASSEANTQAWKDRIAV AEADEGR
GLRDQLAGVTVERWFHPNTMEKKKEVVQWMTEMVAGNSVE
GFR WSCQALWGYDLREKMREVKGVEGLFVVGEGDGKGAL
VKAMEGFRGLLGEK GAELKVVKEAGHLPMCECPEGFWEV
VKDFI

References

Title : The genome sequence of the filamentous fungus Neurospora crassa - Galagan_2003_Nature_422_859
Author(s) : Galagan JE , Calvo SE , Borkovich KA , Selker EU , Read ND , Jaffe D , FitzHugh W , Ma LJ , Smirnov S , Purcell S , Rehman B , Elkins T , Engels R , Wang S , Nielsen CB , Butler J , Endrizzi M , Qui D , Ianakiev P , Bell-Pedersen D , Nelson MA , Werner-Washburne M , Selitrennikoff CP , Kinsey JA , Braun EL , Zelter A , Schulte U , Kothe GO , Jedd G , Mewes W , Staben C , Marcotte E , Greenberg D , Roy A , Foley K , Naylor J , Stange-Thomann N , Barrett R , Gnerre S , Kamal M , Kamvysselis M , Mauceli E , Bielke C , Rudd S , Frishman D , Krystofova S , Rasmussen C , Metzenberg RL , Perkins DD , Kroken S , Cogoni C , Macino G , Catcheside D , Li W , Pratt RJ , Osmani SA , DeSouza CP , Glass L , Orbach MJ , Berglund JA , Voelker R , Yarden O , Plamann M , Seiler S , Dunlap J , Radford A , Aramayo R , Natvig DO , Alex LA , Mannhaupt G , Ebbole DJ , Freitag M , Paulsen I , Sachs MS , Lander ES , Nusbaum C , Birren B
Ref : Nature , 422 :859 , 2003
Abstract : Galagan_2003_Nature_422_859
ESTHER : Galagan_2003_Nature_422_859
PubMedSearch : Galagan_2003_Nature_422_859
PubMedID: 12712197
Gene_locus related to this paper: neucr-5E6.090 , neucr-64C2.080 , neucr-90C4.300 , neucr-a7uw78 , neucr-a7uwh6 , neucr-a7uwy7 , neucr-apth1 , neucr-ATG15 , neucr-B7H23.190 , neucr-B11O8.160 , neucr-B13B3.090 , neucr-B14D6.130 , neucr-B18E6.050 , neucr-B19A17.360 , neucr-B23G1.090 , neucr-CBPYA , neucr-MET5 , neucr-NCU00292.1 , neucr-NCU00350.1 , neucr-NCU00536.1 , neucr-NCU00825.1 , neucr-NCU02148.1 , neucr-NCU02679.1 , neucr-NCU02904.1 , neucr-NCU02924.1 , neucr-NCU03158.1 , neucr-NCU04930.1 , neucr-NCU06332.1 , neucr-NCU06573.1 , neucr-NCU07081.1 , neucr-NCU07415.1 , neucr-NCU07909.1 , neucr-NCU08752.1 , neucr-NCU09575.1 , neucr-NCU10022.1 , neucr-ppme1 , neucr-q6mfs7 , neucr-q7rxb4 , neucr-q7rxv5 , neucr-q7ry06 , neucr-q7ryd2 , neucr-q7rzk2 , neucr-q7s0g7 , neucr-q7s1x0 , neucr-q7s2b3 , neucr-q7s2c5 , neucr-q7s2p4 , neucr-q7s2u9 , neucr-q7s3c6 , neucr-q7s3c8 , neucr-q7s3m2 , neucr-q7s4e3 , neucr-q7s4f8 , neucr-q7s4j4 , neucr-q7s5d6 , neucr-q7s5m2 , neucr-q7s5v8 , neucr-q7s6c5 , neucr-q7s8h2 , neucr-q7s070 , neucr-q7s082 , neucr-q7s134 , neucr-q7s216 , neucr-q7s259 , neucr-q7s260 , neucr-q7s283 , neucr-q7s512 , neucr-q7s736 , neucr-q7s828 , neucr-q7s897 , neucr-q7sbf9 , neucr-q7sbn0 , neucr-q7scr4 , neucr-q7sdw5 , neucr-q7sdx9 , neucr-q7se51 , neucr-q7sea3 , neucr-q7sez8 , neucr-q7sff7 , neucr-q7sga3 , neucr-q7sgj0 , neucr-q7sgp3 , neucr-q7sha3 , neucr-q7sha5 , neucr-q7shu8 , neucr-q9p6a7 , neucr-q872l1 , neucr-f5hbr2 , neucr-q7ry64