neucr-B11O8.160

Neurospora crassa hypothetical protein b11o8.160

Comment

Relationship

Family : Cocaine_esterase

Block : X

Position in NCBI Life Tree : Neurospora crassa

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGDASQPRTIHGPPRLLDIQTTVPDPRILFMKNVSIPLKS
SPFPIRANIY LPKPCASSPGLDVNEPQPEVQSKKYPVIV
TYGPYGKDIPYSSFHPGSFAE VNAEQRSEFSAWETPDPV
YWCKQGYAVVRADERGTGQSPGLLDTMSKDTS DAFCQVI
EWCAEQEWSNGKVGLLGVSYYAGSQWRVAARRPKGLAAII
PWE GMSDYYRDRCRHGGILSNNFIDIWWNRQVLVNQYGL
PGRSELKFPPDGPS ARGQEDTIEGDLSEEQLVSNRNDQT
KDNEAHRFRDEDYYASKEYRLEDIE VPVLSVANWGGITL
HLRGNVLGYTYAGSRFKYLRFITGRHDLPFYYKEHV ELQ
KSFLDAFLKGEDKVGWSIPDKVSPIEVTLRKGNVGFNDAE
KEKAYKR RNEGQWPLYSTEYTDFYLGSDHTLSRNRPDPT
MPAQIGYKALESLDKPEL VQFVTAPFEKETEITGHIVAH
LNVSVTPENTQNEADIDLFLTIRHIDRSG NEVFYTGTAG
DPVPVCKGWLRVSNRKVHEENPRHKPWLPFREYFSTDVLP
VKAGEVYGVDVELWPTNVVVGVGGGILLEVSSGDTQGAG
IFQHNSETDRP ASKFAGQNHIHFGEGFDNYVTLPIIPEH
I

References

Title : The genome sequence of the filamentous fungus Neurospora crassa - Galagan_2003_Nature_422_859
Author(s) : Galagan JE , Calvo SE , Borkovich KA , Selker EU , Read ND , Jaffe D , FitzHugh W , Ma LJ , Smirnov S , Purcell S , Rehman B , Elkins T , Engels R , Wang S , Nielsen CB , Butler J , Endrizzi M , Qui D , Ianakiev P , Bell-Pedersen D , Nelson MA , Werner-Washburne M , Selitrennikoff CP , Kinsey JA , Braun EL , Zelter A , Schulte U , Kothe GO , Jedd G , Mewes W , Staben C , Marcotte E , Greenberg D , Roy A , Foley K , Naylor J , Stange-Thomann N , Barrett R , Gnerre S , Kamal M , Kamvysselis M , Mauceli E , Bielke C , Rudd S , Frishman D , Krystofova S , Rasmussen C , Metzenberg RL , Perkins DD , Kroken S , Cogoni C , Macino G , Catcheside D , Li W , Pratt RJ , Osmani SA , DeSouza CP , Glass L , Orbach MJ , Berglund JA , Voelker R , Yarden O , Plamann M , Seiler S , Dunlap J , Radford A , Aramayo R , Natvig DO , Alex LA , Mannhaupt G , Ebbole DJ , Freitag M , Paulsen I , Sachs MS , Lander ES , Nusbaum C , Birren B
Ref : Nature , 422 :859 , 2003
Abstract : Galagan_2003_Nature_422_859
ESTHER : Galagan_2003_Nature_422_859
PubMedSearch : Galagan_2003_Nature_422_859
PubMedID: 12712197
Gene_locus related to this paper: neucr-5E6.090 , neucr-64C2.080 , neucr-90C4.300 , neucr-a7uw78 , neucr-a7uwh6 , neucr-a7uwy7 , neucr-apth1 , neucr-ATG15 , neucr-B7H23.190 , neucr-B11O8.160 , neucr-B13B3.090 , neucr-B14D6.130 , neucr-B18E6.050 , neucr-B19A17.360 , neucr-B23G1.090 , neucr-CBPYA , neucr-MET5 , neucr-NCU00292.1 , neucr-NCU00350.1 , neucr-NCU00536.1 , neucr-NCU00825.1 , neucr-NCU02148.1 , neucr-NCU02679.1 , neucr-NCU02904.1 , neucr-NCU02924.1 , neucr-NCU03158.1 , neucr-NCU04930.1 , neucr-NCU06332.1 , neucr-NCU06573.1 , neucr-NCU07081.1 , neucr-NCU07415.1 , neucr-NCU07909.1 , neucr-NCU08752.1 , neucr-NCU09575.1 , neucr-NCU10022.1 , neucr-ppme1 , neucr-q6mfs7 , neucr-q7rxb4 , neucr-q7rxv5 , neucr-q7ry06 , neucr-q7ryd2 , neucr-q7rzk2 , neucr-q7s0g7 , neucr-q7s1x0 , neucr-q7s2b3 , neucr-q7s2c5 , neucr-q7s2p4 , neucr-q7s2u9 , neucr-q7s3c6 , neucr-q7s3c8 , neucr-q7s3m2 , neucr-q7s4e3 , neucr-q7s4f8 , neucr-q7s4j4 , neucr-q7s5d6 , neucr-q7s5m2 , neucr-q7s5v8 , neucr-q7s6c5 , neucr-q7s8h2 , neucr-q7s070 , neucr-q7s082 , neucr-q7s134 , neucr-q7s216 , neucr-q7s259 , neucr-q7s260 , neucr-q7s283 , neucr-q7s512 , neucr-q7s736 , neucr-q7s828 , neucr-q7s897 , neucr-q7sbf9 , neucr-q7sbn0 , neucr-q7scr4 , neucr-q7sdw5 , neucr-q7sdx9 , neucr-q7se51 , neucr-q7sea3 , neucr-q7sez8 , neucr-q7sff7 , neucr-q7sga3 , neucr-q7sgj0 , neucr-q7sgp3 , neucr-q7sha3 , neucr-q7sha5 , neucr-q7shu8 , neucr-q9p6a7 , neucr-q872l1 , neucr-f5hbr2 , neucr-q7ry64