pedhb-ACHE1

Pediculus humanus corporis (human body louse) Ace2 acetylcholinesterase

Comment

"long n-term sequence not included"

Relationship

Family : ACHE

Block : C

Position in NCBI Life Tree : Pediculus humanus corporis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

GGGASVQTQSAHFVEHDSLKFSERNNLGLGEGNMHLNRKD
RSEFGAQNKD LKNDYRFVDDKKNDPLIVSTTKGKVRGVT
LQGANGKYVDAWLGIPYAQKP IGNLRFRHPRPIEKWDPE
IFNATKPPNSCVQILDTVFGDFPGATMWNPNT PLSEDCL
YINVVVPKPRPRKSAVMVWIFGGGFYSGTATLDVYDPKTL
VSE ENVIVVSMQYRIASLGFLYFGTPDVPGNAGLFDQLM
ALQWVHDNIRSFGG NPYNVTLFGESAGAVSVSTHLLSPL
SRNLFSQAIMESGSPTAPWAIIPTE ESILRGLRLAEAVN
CPHDRFQLSAVVECLRNTNASLLVNNEWGTLGICEF PFV
PVIDGAFLDELPELALANKNFKKTNILMGSNTEEGYYFII
YYLTELL RKEENVYVNRDEFIKAVRELNPYINNIARQAI
IFEYTDWLNPDDPARNRD ALDKMVGDYHFTCSVNEFAHR
YAETGNKVYMYYFTHRSAGNPWPSWTGVM HGDEINYIFG
EPLNPLKNYQVEEQELSRRIMRYWANFAKTGNPSMSEDGT
WTPVVWPEHTAHGREYLTLAVNNTSTGRGPRLKQCAFWK
KYLPQLLALTK NIKSNNQIQNCQSKGSKSTFLHFSHFIP
PYFTLLLLLLLSLGKIF

References

Title : Genome sequences of the human body louse and its primary endosymbiont provide insights into the permanent parasitic lifestyle - Kirkness_2010_Proc.Natl.Acad.Sci.U.S.A_107_12168
Author(s) : Kirkness EF , Haas BJ , Sun W , Braig HR , Perotti MA , Clark JM , Lee SH , Robertson HM , Kennedy RC , Elhaik E , Gerlach D , Kriventseva EV , Elsik CG , Graur D , Hill CA , Veenstra JA , Walenz B , Tubio JM , Ribeiro JM , Rozas J , Johnston JS , Reese JT , Popadic A , Tojo M , Raoult D , Reed DL , Tomoyasu Y , Kraus E , Mittapalli O , Margam VM , Li HM , Meyer JM , Johnson RM , Romero-Severson J , Vanzee JP , Alvarez-Ponce D , Vieira FG , Aguade M , Guirao-Rico S , Anzola JM , Yoon KS , Strycharz JP , Unger MF , Christley S , Lobo NF , Seufferheld MJ , Wang N , Dasch GA , Struchiner CJ , Madey G , Hannick LI , Bidwell S , Joardar V , Caler E , Shao R , Barker SC , Cameron S , Bruggner RV , Regier A , Johnson J , Viswanathan L , Utterback TR , Sutton GG , Lawson D , Waterhouse RM , Venter JC , Strausberg RL , Berenbaum MR , Collins FH , Zdobnov EM , Pittendrigh BR
Ref : Proc Natl Acad Sci U S A , 107 :12168 , 2010
Abstract : Kirkness_2010_Proc.Natl.Acad.Sci.U.S.A_107_12168
ESTHER : Kirkness_2010_Proc.Natl.Acad.Sci.U.S.A_107_12168
PubMedSearch : Kirkness_2010_Proc.Natl.Acad.Sci.U.S.A_107_12168
PubMedID: 20566863
Gene_locus related to this paper: pedhb-ACHE1 , pedhb-ACHE2 , pedhc-e0v9b5 , pedhc-e0v9b6 , pedhc-e0v9b7 , pedhc-e0vbv5 , pedhc-e0vcd0 , pedhc-e0vcl7 , pedhc-e0vd69 , pedhc-e0ve50 , pedhc-e0vel6 , pedhc-e0vel7 , pedhc-e0vf98 , pedhc-e0vfs8 , pedhc-e0vfv0 , pedhc-e0vg01 , pedhc-e0vha2 , pedhc-e0vha4 , pedhc-e0vi52 , pedhc-e0vp42 , pedhc-e0vqu6 , pedhc-e0vuj9 , pedhc-e0vup6 , pedhc-e0vv55 , pedhc-e0vwv3 , pedhc-e0vxf7 , pedhc-e0vxg1 , pedhc-e0w4a6 , pedhc-e0w4c8 , pedhc-e0w271 , pedhc-e0w444 , pedhc-e0vym0 , pedhc-e0vdk9 , pedhc-e0vk10 , pedhc-e0vgw4 , pedhc-e0vgw7 , pedhc-e0vga1 , pedhc-e0w3s1 , pedhc-e0vzt2

Title : Molecular characterization of two acetylcholinesterase cDNAs in Pediculus human lice - Lee_2007_J.Med.Entomol_44_72
Author(s) : Lee SW , Kasai S , Komagata O , Kobayashi M , Agui N , Kono Y , Tomita T
Ref : Journal of Medical Entomology , 44 :72 , 2007
Abstract : Lee_2007_J.Med.Entomol_44_72
ESTHER : Lee_2007_J.Med.Entomol_44_72
PubMedSearch : Lee_2007_J.Med.Entomol_44_72
PubMedID: 17294923
Gene_locus related to this paper: pedhb-ACHE1 , pedhb-ACHE2 , pedhc-ACHE1 , pedhc-ACHE2