tubmm-TmEst2

Tuber melanosporum (strain Mel28) (Perigord black truffle).carboxyl esterase 2 (TmelEST2)

Comment

Relationship

Family : Hormone-sensitive_lipase_like

Block : H

Position in NCBI Life Tree : Tuber melanosporum

Molecular evidence

No mutation

No kinetic

No disease

No substrate

Database

Sequence

Peptide

MRFTILSVLAFSLPLVLAETPAPSCPVTNVTTPQLDPITQ
AYADAISSRP SLFAFPLPEIRDGYQSNVSDPSTEFTTKI
LSLPVGPTGNVTAYLYKPVSG EREKGKDLLPVIAYFHGG
GWVFGGPKSYRGLITNLIRESGAAVFFVDYTL TPKVAYP
VPNEQCYAAVQWLLEHGEKLGVDPTNMGFGGDSAGGELSS
SVS LLSIKRKTPLPKFQVLIYPATDLACESATFKEFPNG
PGLTTDEIRFAASL FTPDPKSRLEDVASPGRASDEDLAK
FPETLIVVAEVDPIRQQGEDFGRRL QKLGVRAAIIRVLG
TIHGFASIDVLSEAPGAKATIELIGYKFKKALH

References

Title : A family of archaea-like carboxylesterases preferentially expressed in the symbiotic phase of the mychorrizal fungus Tuber melanosporum - Cavazzini_2017_Sci.Rep_7_7628
Author(s) : Cavazzini D , Grossi G , Levati E , Vallese F , Montanini B , Bolchi A , Zanotti G , Ottonello S
Ref : Sci Rep , 7 :7628 , 2017
Abstract : Cavazzini_2017_Sci.Rep_7_7628
ESTHER : Cavazzini_2017_Sci.Rep_7_7628
PubMedSearch : Cavazzini_2017_Sci.Rep_7_7628
PubMedID: 28794466
Gene_locus related to this paper: tubmm-TmEst2 , tubmm-TmEst1 , tubmm-TmEst3