9entr-EsEstB

 
Enterobacter sp.; Enterobacter cloacae; Enterobacter hormaechei Bis(2-hydroxyethyl) terephthalate ester esterase EsEstB

Comment
Other strains: Enterobacter sp.; Enterobacter cloacae; Enterobacter hormaechei


Relationship
Block X
Enterobacter sp. position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Enterobacter: N E > Enterobacter sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 2 more: QDD67397, WP_023295120, PAC69968
2 UniProt : A0A4Y5UXE5, A0A7G3EU07
2 UniProtTrembl : A0A4Y5UXE5, A0A7G3EU07
2 Interpro : A0A4Y5UXE5, A0A7G3EU07
2 Prodom : A0A4Y5UXE5, A0A7G3EU07
2 Pfam : A0A4Y5UXE5, A0A7G3EU07
2 PIRSF : A0A4Y5UXE5, A0A7G3EU07
2 SUPERFAM : A0A4Y5UXE5, A0A7G3EU07
2 QuickSwissBlast : A0A4Y5UXE5, A0A7G3EU07
 
Sequence
Graphical view for this peptide sequence: 9entr-EsEstB
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MKHDHFVVQSPDTPAKQLLLLFHGVGDNAVNMGQIGSWFAPVFPHALIVS
IGGVEPCGPDGRQWFSVEGVTEENRQARIDAAMPAFIDTVRYWQQQSGVG
ADATALIGFSQGSIMSLESVKAQPGLVSRVIAFNGRFATLPQSATTQTTI
HLIHGGEDRVIELSHAVAAQETLMREGGDVTLDIVDDLGHAIDDRSMQFA
LDHLRYTVPKHYFDEALSGGKPNDDDIVEFM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKHDHFVVQSPDTPAKQLLLLFHGVGDNAVNMGQIGSWFAPVFPHALIVS
IGGVEPCGPDGRQWFSVEGVTEENRQARIDAAMPAFIDTVRYWQQQSGVG
ADATALIGFSQGSIMSLESVKAQPGLVSRVIAFNGRFATLPQSATTQTTI
HLIHGGEDRVIELSHAVAAQETLMREGGDVTLDIVDDLGHAIDDRSMQFA
LDHLRYTVPKHYFDEALSGGKPNDDDIVEFM

no DNA




Reference
    Title: Perspectives on the Role of Enzymatic Biocatalysis for the Degradation of Plastic PET
    Magalhaes RP, Cunha JM, Sousa SF
    Ref: Int J Mol Sci, 22:11257, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer