Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aerpe-APE1547

Aeropyrum pernix 582aa long hypothetical acylamino-acid-releasing enzyme ApAAP

Comment
AARE Acyl-peptide hydrolase APH Acylaminoacyl-peptidase


Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Aeropyrum pernix
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Crenarchaeota: N E > Thermoprotei: N E > Desulfurococcales: N E > Desulfurococcaceae: N E > Aeropyrum: N E > Aeropyrum pernix: N E


Molecular evidence
Database
No mutation
13 structures (e.g. : 1VE6, 1VE7, 2HU5... more)
No kinetic





3 substrates: Abz-Gly-Phe-OH, Octylglucoside, P-nitrophenyl-phosphate
3 inhibitors: Ac-Phe-OH, Gly-Phe-OH, Z-Gly-Gly-Phe-chloromethyl-ketone
1 Genbank : AP000061
1 UniProt : Q9YBQ2
>3 Structure links 10 more: 1VE6, 1VE7, 4RE5
1 UniProt : Q9YBQ2
1 Interpro : Q9YBQ2
1 Prodom : Q9YBQ2
1 Pfam : Q9YBQ2
1 PIRSF : Q9YBQ2
1 SUPERFAM : Q9YBQ2
Sequence
Graphical view for this peptide sequence: aerpe-APE1547
Colored MSA for ACPH_Peptidase_S9 (raw)
MRIIMPVEFSRIVRDVERLIAVEKYSLQGVVDGDKLLVVGFSEGSVNAYL
YDGGETVKLNREPINSVLDPHYGVGRVILVRDVSKGAEQHALFKVNTSRP
GEEQRLEAVKPMRILSGVDTGEAVVFTGATEDRVALYALDGGGLRELARL
PGFGFVSDIRGDLIAGLGFFGGGRVSLFTSNLSSGGLRVFDSGEGSFSSA
SISPGMKVTAGLETAREARLVTVDPRDGSVEDLELPSKDFSSYRPTAITW
LGYLPDGRLAVVARREGRSAVFIDGERVEAPQGNHGRVVLWRGKLVTSHT
SLSTPPRIVSLPSGEPLLEGGLPEDLRRSIAGSRLVWVESFDGSRVPTYV
LESGRAPTPGPTVVLVHGGPFAEDSDSWDTFAASLAAAGFHVVMPNYRGS
TGYGEEWRLKIIGDPCGGELEDVSAAARWARESGLASELYIMGYSYGGYM
TLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQLTGGSREIM
RSRSPINHVDRIKEPLALIHPQNDSRTPLKPLLRLMGELLARGKTFEAHI
IPDAGHAINTMEDAVKILLPAVFFLATQRERR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRIIMPVEFSRIVRDVERLIAVEKYSLQGVVDGDKLLVVGFSEGSVNAYL
YDGGETVKLNREPINSVLDPHYGVGRVILVRDVSKGAEQHALFKVNTSRP
GEEQRLEAVKPMRILSGVDTGEAVVFTGATEDRVALYALDGGGLRELARL
PGFGFVSDIRGDLIAGLGFFGGGRVSLFTSNLSSGGLRVFDSGEGSFSSA
SISPGMKVTAGLETAREARLVTVDPRDGSVEDLELPSKDFSSYRPTAITW
LGYLPDGRLAVVARREGRSAVFIDGERVEAPQGNHGRVVLWRGKLVTSHT
SLSTPPRIVSLPSGEPLLEGGLPEDLRRSIAGSRLVWVESFDGSRVPTYV
LESGRAPTPGPTVVLVHGGPFAEDSDSWDTFAASLAAAGFHVVMPNYRGS
TGYGEEWRLKIIGDPCGGELEDVSAAARWARESGLASELYIMGYSYGGYM
TLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQLTGGSREIM
RSRSPINHVDRIKEPLALIHPQNDSRTPLKPLLRLMGELLARGKTFEAHI
IPDAGHAINTMEDAVKILLPAVFFLATQRERR


References
8 more
    Title: Crystal Structure of an Acylpeptide Hydrolase/Esterase from Aeropyrum pernix K1.
    Bartlam M, Wang G, Yang H, Gao R, Zhao X, Xie G, Cao S, Feng Y, Rao Z
    Ref: Structure(Camb), 12:1481, 2004 : PubMed

            

    Title: Crystallization and preliminary crystallographic analysis of acylamino-acid releasing enzyme from the hyperthermophilic archaeon Aeropyrum pernix
    Wang G, Gao R, Ding Y, Yang H, Cao S, Feng Y, Rao Z
    Ref: Acta Crystallographica D Biol Crystallogr, 58:1054, 2002 : PubMed

            

    Title: Complete genome sequence of an aerobic hyper-thermophilic crenarchaeon, Aeropyrum pernix K1
    Kawarabayasi Y, Hino Y, Horikawa H, Yamazaki S, Haikawa Y, Jin-no K, Takahashi M, Sekine M, Baba S and Kikuchi H <20 more author(s)>
    Ref: DNA Research, 6:83, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer