Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arall-d7mb17

Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Putative uncharacterized protein

Relationship
Family|Hydroxynitrile_lyase
Block| X
Position in NCBI Life Tree|Arabidopsis lyrata subsp. lyrata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis lyrata: N E > Arabidopsis lyrata subsp. lyrata: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GL348719
1 UniProt : D7MB17
1 UniProt : D7MB17
1 Interpro : D7MB17
1 Prodom : D7MB17
1 Pfam : D7MB17
1 PIRSF : D7MB17
1 SUPERFAM : D7MB17
Sequence
Graphical view for this peptide sequence: arall-d7mb17
Colored MSA for Hydroxynitrile_lyase (raw)
MKHYVLVHGGCHGAWCWYKVKPVLEASGHRVTVVDLTASGVNMSKVEEIQ
TLEDYAKPLLKVLESFGSEDKVILVAHSLGGISVGLAADMFPSKISVAVF
ITSFMPDTTNPPSYVFEKYLGSVMEEDRLNMEFGTYGRHDRPLTTILLGT
KYLAKKMYQLSPIEDFELAKTLVRVGPAVTRNLTGTRSLTEEGYGSVTRV
YIVCQEDKGLTEEFQRWIIENFPVEEVMEIKDADHMPMFSKPLELCDRLL
RIADKYPKLRY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKHYVLVHGGCHGAWCWYKVKPVLEASGHRVTVVDLTASGVNMSKVEEIQ
TLEDYAKPLLKVLESFGSEDKVILVAHSLGGISVGLAADMFPSKISVAVF
ITSFMPDTTNPPSYVFEKYLGSVMEEDRLNMEFGTYGRHDRPLTTILLGT
KYLAKKMYQLSPIEDFELAKTLVRVGPAVTRNLTGTRSLTEEGYGSVTRV
YIVCQEDKGLTEEFQRWIIENFPVEEVMEIKDADHMPMFSKPLELCDRLL
RIADKYPKLRY


Reference
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer