Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspna-g3xpq9

Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Uncharacterized protein

Relationship
Family|Canar_LipB
Block| L
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ACJE01000003
1 UniProt : G3XPQ9
1 UniProt : G3XPQ9
1 Interpro : G3XPQ9
1 Pfam : G3XPQ9
1 PIRSF : G3XPQ9
1 SUPERFAM : G3XPQ9
Sequence
Graphical view for this peptide sequence: aspna-g3xpq9
Colored MSA for Canar_LipB (raw)
MLDLAKDIVASGLVPPKILAFLNGYLDAKINSAHNLNPDLKSGSIYPSKA
TEDAPYSIPEAALREAIHMPNLFSGESNSGRKPVILVPGTAAPAGTSFYY
NFGKLGNAIPEIDVSWVNIPQASLGDVQVTAEYIAYSINYISSLYRSKVN
VISWSQGGLNTQWALKYWPSTRDSVEDFIAISPDFRGTIETRLVCPWLAG
IMCTPALWQQGWDAKFVRTLRGFGGESAYVHTTTIYSSFDEIVQPMYGDQ
ASAILQDARGVGVSNNHLQSICAHEPAGGMYTHRGVLYNPLAWALTIDAL
THDGPGRPSRVNVTTVCQQSIPPQLGLDDLLGTEGLLLVSLSETLRYRPK
TFAEPDILGYAASAPGVGGEIWDLKDEQF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLDLAKDIVASGLVPPKILAFLNGYLDAKINSAHNLNPDLKSGSIYPSKA
TEDAPYSIPEAALREAIHMPNLFSGESNSGRKPVILVPGTAAPAGTSFYY
NFGKLGNAIPEIDVSWVNIPQASLGDVQVTAEYIAYSINYISSLYRSKVN
VISWSQGGLNTQWALKYWPSTRDSVEDFIAISPDFRGTIETRLVCPWLAG
IMCTPALWQQGWDAKFVRTLRGFGGESAYVHTTTIYSSFDEIVQPMYGDQ
ASAILQDARGVGVSNNHLQSICAHEPAGGMYTHRGVLYNPLAWALTIDAL
THDGPGRPSRVNVTTVCQQSIPPQLGLDDLLGTEGLLLVSLSETLRYRPK
TFAEPDILGYAASAPGVGGEIWDLKDEQF


Reference
    Title: Comparative genomics of citric-acid-producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88
    Andersen MR, Salazar MP, Schaap PJ, van de Vondervoort PJ, Culley D, Thykaer J, Frisvad JC, Nielsen KF, Albang R and Baker SE <37 more author(s)>
    Ref: Genome Res, 21:885, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer