Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspnc-a2r1p3

Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: 3-Oxoadipate enol-lactone + H2O = 3-Oxoadipate

Comment
Only c-term PfamA Abhydrolase_1 347 543


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM270300
1 UniProt : A2R1P3
1 UniProt : A2R1P3
1 Interpro : A2R1P3
1 Pfam : A2R1P3
1 PIRSF : A2R1P3
1 SUPERFAM : A2R1P3
Sequence
Graphical view for this peptide sequence: aspnc-a2r1p3
Colored MSA for 6_AlphaBeta_hydrolase (raw)
VESFVTTPDGVELPYRLEGSTDPHSPVIVLSNSILVDYTIWDDFIDQFLS
DPRNQNFRIVRYCTRGRQQECGDKPVNIDLLASDIIALLDALRVPKATLI
GVSLGGVTVLNTSLLYPERVERFISCDTNSSSPETNRKAWNERVELAASE
GAVSATTQQAIVGEQLAEITVRRWFTAESYETQPHLPAKAKELVRTNSLP
GFRQSVQALCAYDVRDRMAQAQVPGLFVAGESDGVLPKTMQQMVADLKSD
SELKLVPKAGHLPMLENAAAFTAVVNEYLH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VESFVTTPDGVELPYRLEGSTDPHSPVIVLSNSILVDYTIWDDFIDQFLS
DPRNQNFRIVRYCTRGRQQECGDKPVNIDLLASDIIALLDALRVPKATLI
GVSLGGVTVLNTSLLYPERVERFISCDTNSSSPETNRKAWNERVELAASE
GAVSATTQQAIVGEQLAEITVRRWFTAESYETQPHLPAKAKELVRTNSLP
GFRQSVQALCAYDVRDRMAQAQVPGLFVAGESDGVLPKTMQQMVADLKSD
SELKLVPKAGHLPMLENAAAFTAVVNEYLH


Reference
    Title: Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88
    Pel HJ, de Winde JH, Archer DB, Dyer PS, Hofmann G, Schaap PJ, Turner G, de Vries RP, Albang R and Stam H <59 more author(s)>
    Ref: Nat Biotechnol, 25:221, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer