Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspor-q2u728

Aspergillus oryzae predicted alpha/beta hydrolase

Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Aspergillus oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP007165
1 UniProt : Q2U728
1 UniProt : Q2U728
1 Interpro : Q2U728
1 Pfam : Q2U728
1 PIRSF : Q2U728
1 SUPERFAM : Q2U728
Sequence
Graphical view for this peptide sequence: aspor-q2u728
Colored MSA for Duf_676 (raw)
MEIKEHMYVLATMVPRLEREYTVTYTPAADTASSIPGELFVKVKNTSAIP
LRAAYLHGPYTLYTSCYPSTFDPNVKLDQQATEGIPQFEPYLKAGGSWNA
VITVPRRLRQKPEVASAEPQSHQKVTWIIEIVSQVIFSSTASVNFELLVG
RDQKSVELYSSSAASTTGFQAAQLSDHWLPNAKGKQVFATNGVYSRSITL
QIDDTVSLWNTPAFPSSDKSCGAEKDKGPSEDSPTNNDEASTRPSEPVNQ
SHNNRRKKKIHLVVLTHGLHSNLGADMLYLKESIDTAARKAKEQAYNARQ
KHKSEQSSNHDADADADDADDADDADDADDADDADDADDADDDDDDDDDD
DDDDDDEQVIVRGFPGNAVRTERGIQYLGKRLAKYVLLMTYPDQPCNPYH
NAKAKTLPKSLAPWRNAAAEFPKDHTASVPGPTGGGHAYRVTSISFIGHS
LGGLIQTYAIAYIQKHSPEFFDVVRPVNFIALATPFLGLSNENPMYIRFA
LDLGLVGRTGQDLGLSWTAPRVRSGWESIIGGKGNSSKQQGQSDAGSKPL
LRILPCGPAHEVLAKFQHRTVYSNVVNDGIVPLRTSCLLFLDWRGLERVE
KARRENGIGPPSPCAPTHESYADSQPSEEYGLYAPPKTTLFESASDLLMP
PLPPIEFIIDPTSRPRTIFHDRVYSPEDIPPPLTPKRRTLTFGSSQSKVS
KTGPFSSDESPHRGSNESESGLKVEEKIARAYHRDLTWRKVLVRLEPDAH
NNIIVRRMFTNAYGWPVVKHLVDTHFGYTSAAQSKDDSAKRVERAMPPAV
PTNSLGEEVQGQVEHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEIKEHMYVLATMVPRLEREYTVTYTPAADTASSIPGELFVKVKNTSAIP
LRAAYLHGPYTLYTSCYPSTFDPNVKLDQQATEGIPQFEPYLKAGGSWNA
VITVPRRLRQKPEVASAEPQSHQKVTWIIEIVSQVIFSSTASVNFELLVG
RDQKSVELYSSSAASTTGFQAAQLSDHWLPNAKGKQVFATNGVYSRSITL
QIDDTVSLWNTPAFPSSDKSCGAEKDKGPSEDSPTNNDEASTRPSEPVNQ
SHNNRRKKKIHLVVLTHGLHSNLGADMLYLKESIDTAARKAKEQAYNARQ
KHKSEQSSNHDADADADDADDADDADDADDADDADDADDADDDDDDDDDD
DDDDDDEQVIVRGFPGNAVRTERGIQYLGKRLAKYVLLMTYPDQPCNPYH
NAKAKTLPKSLAPWRNAAAEFPKDHTASVPGPTGGGHAYRVTSISFIGHS
LGGLIQTYAIAYIQKHSPEFFDVVRPVNFIALATPFLGLSNENPMYIRFA
LDLGLVGRTGQDLGLSWTAPRVRSGWESIIGGKGNSSKQQGQSDAGSKPL
LRILPCGPAHEVLAKFQHRTVYSNVVNDGIVPLRTSCLLFLDWRGLERVE
KARRENGIGPPSPCAPTHESYADSQPSEEYGLYAPPKTTLFESASDLLMP
PLPPIEFIIDPTSRPRTIFHDRVYSPEDIPPPLTPKRRTLTFGSSQSKVS
KTGPFSSDESPHRGSNESESGLKVEEKIARAYHRDLTWRKVLVRLEPDAH
NNIIVRRMFTNAYGWPVVKHLVDTHFGYTSAAQSKDDSAKRVERAMPPAV
PTNSLGEEVQGQVEHL


Reference
    Title: Genome sequencing and analysis of Aspergillus oryzae
    Machida M, Asai K, Sano M, Tanaka T, Kumagai T, Terai G, Kusumoto K, Arima T, Akita O and Kikuchi H <54 more author(s)>
    Ref: Nature, 438:1157, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer