Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burce-lipaa

Pseudomonas cepacia lipase, Burkholderia sp., lipase (lipA) PCL

Comment
Other strains Pseudomonas cepacia, Burkholderia sp. MC16-3, sp. 99-2-1, strain 383 Bornscheuer_1994 Q9R4W9 very short fragment. Another short fragment from Pseudomonas fluorescens is identical Trembl Q9R4V3 Kojima_1994


Relationship
Family|Bacterial_lip_FamI.2
Block| L
Position in NCBI Life Tree|Burkholderia cepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cepacia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
7 structures (e.g. : 1OIL, 1YS1, 1YS2... more)
No kinetic





2 substrates: (R,S)-DMPM, Isopropenyl-acetate
5 inhibitors (e.g. : Butylphosphonic-acid, Hexyl(2R)-2-methyl-3-phenylpropoxyphosphinic-acid, Hexyl(2S)-2-methyl-3-phenylpropoxyphosphinic-acid... more)
>3 Genbank links 3 more: AY772173, M58494, AY682925
>3 UniProt links 2 more: P22088, Q5U9G2, Q5U9G1
2 Ncbi-nid : 557866, 557866 512793
1 Ncbi-pid : 557867
>3 Structure links 4 more: 5LIP, 4LIP, 1OIL
>3 UniProt links 4 more: Q5U9G2, Q5U9G1, Q6B4I1
>3 Interpro links 4 more: Q5U9G2, Q5U9G1, Q6B4I1
>3 Prodom links 4 more: Q5U9G2, Q5U9G1, Q6B4I1
>3 Pfam links 4 more: Q5U9G2, Q5U9G1, Q6B4I1
>3 PIRSF links 4 more: Q5U9G2, Q5U9G1, Q6B4I1
>3 SUPERFAM links 4 more: Q5U9G2, Q5U9G1, Q6B4I1
Sequence
Graphical view for this peptide sequence: burce-lipaa
Colored MSA for Bacterial_lip_FamI.2 (raw)
MARTMRSRVVAGAVACAMSIAPFAGTTAVMTLATTHAAMAATAPAAGYAA
TRYPIILVHGLSGTDKYAGVLEYWYGIQEDLQQNGATVYVANLSGFQSDD
GPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLSSRYVAAVAPDLVAS
VTTIGTPHRGSEFADFVQDVLAYDPTGLSSSVIAAFVNVFGILTSSSHNT
NQDALAALQTLTTARAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLL
YSWAGTAIQPTLSVFGVTGATDTSTLPLVDPANVLDLSTLALFGTGTVMI
NRGSGQNDGLVSKCSALYGKVLSTSYKWNHLDEINQLLGVRGAYAEDPVA
VIRTHANRLKLAGV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARTMRSRVVAGAVACAMSIAPFAGTTAVMTLATTHAAMAATAPAAGYAA
TRYPIILVHGLSGTDKYAGVLEYWYGIQEDLQQNGATVYVANLSGFQSDD
GPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLSSRYVAAVAPDLVAS
VTTIGTPHRGSEFADFVQDVLAYDPTGLSSSVIAAFVNVFGILTSSSHNT
NQDALAALQTLTTARAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLL
YSWAGTAIQPTLSVFGVTGATDTSTLPLVDPANVLDLSTLALFGTGTVMI
NRGSGQNDGLVSKCSALYGKVLSTSYKWNHLDEINQLLGVRGAYAEDPVA
VIRTHANRLKLAGV


References
10 more
    Title: Enhancement of protein thermostability by three consecutive mutations using loop-walking method and machine learning
    Yoshida K, Kawai S, Fujitani M, Koikeda S, Kato R, Ema T
    Ref: Sci Rep, 11:11883, 2021 : PubMed

            

    Title: Co-expression, purification and characterization of the lipase and foldase of Burkholderia contaminans LTEB11
    Alnoch RC, Stefanello AA, Paula Martini V, Richter JL, Mateo C, Souza EM, Mitchell DA, Muller-Santos M, Krieger N
    Ref: Int J Biol Macromol, 116:1222, 2018 : PubMed

            

    Title: Cloning, sequence, and expression of a lipase gene from Pseudomonas cepacia: lipase production in heterologous hosts requires two Pseudomonas genes
    Jorgensen S, Skov KW, Diderichsen B
    Ref: Journal of Bacteriology, 173:559, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer