Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: echgr-a0a068wgw1

Echinococcus granulosus (Hydatid tapeworm), Echinococcus multilocularis (Fox tapeworm). Family S9 non peptidase ue S09 family

Comment
Other strains: Echinococcus granulosus (Hydatid tapeworm), Echinococcus multilocularis (Fox tapeworm)


Relationship
Family|Neurotactin
Block| C
Position in NCBI Life Tree|Echinococcus granulosus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Cestoda: N E > Eucestoda: N E > Cyclophyllidea: N E > Taeniidae: N E > Echinococcus: N E > Echinococcus granulosus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: echgr-a0a068wgw1
Colored MSA for Neurotactin (raw)
MACSRVRVIEYRKRLDPEEFFQYGRPHVEPPGIVVVCHRPLDKILLYLIA
FSLLGVIIHFIVAYILLSDFPKPPPNASTDCATLVGSWNSDYTVLRFFGV
PYSIPPLAKPDEQTLDVLRQYLQVEDGMPVLRWQMPREIEGIEGCILAQH
DRCSFQRSRWTCNLGRARPVGTCSQPIPGRQVDLNNSYALFQQERCLQVD
ITTPLYGGVLKPVIVLIAGFQFFTEPLMPPHHQYVAFWPTDEAVRDTDAV
WVYLHYRLGLAGFFYNLTAPNASDTTKYQLSIENFALHDQLMGLRWIKQH
VKQFGGDPKRITVLGWGSGATSTLALLYMKAKKEELFHQAWLTSGAVHWK
SNRDNDVNRSMVERAFTDIVSHYIGTHCITGIPGTVSKSCPLGELRKKLA
NVPIAVFNSLLSGLLDDGNMIGGLVGSNNESGGLSWISAESGSGAIPPPR
YWTPEEIKRILDLDEKPVRLVFSSMSNELEGWPDMDDPWMNQADDEQIEQ
FAEMLYRFKRPSSYSLQGLKHLLGVAWRKELSHTRSKAIRRSRQEFHLEL
LSLLRFSCPQSWIVSKLNASKGIFYKVLLDEPSDLVVPYAPGPRFMGKST
PPPKRFAFHALDMMILTGKRIGSRKSGSRDTPRKKRFQNFKRELKQMFKD
FVHGKNMDSRCKATATDPYGCHITADGIKVLGRNEIQTGVCELIDWEKWI
SKIIVYN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MACSRVRVIEYRKRLDPEEFFQYGRPHVEPPGIVVVCHRPLDKILLYLIA
FSLLGVIIHFIVAYILLSDFPKPPPNASTDCATLVGSWNSDYTVLRFFGV
PYSIPPLAKPDEQTLDVLRQYLQVEDGMPVLRWQMPREIEGIEGCILAQH
DRCSFQRSRWTCNLGRARPVGTCSQPIPGRQVDLNNSYALFQQERCLQVD
ITTPLYGGVLKPVIVLIAGFQFFTEPLMPPHHQYVAFWPTDEAVRDTDAV
WVYLHYRLGLAGFFYNLTAPNASDTTKYQLSIENFALHDQLMGLRWIKQH
VKQFGGDPKRITVLGWGSGATSTLALLYMKAKKEELFHQAWLTSGAVHWK
SNRDNDVNRSMVERAFTDIVSHYIGTHCITGIPGTVSKSCPLGELRKKLA
NVPIAVFNSLLSGLLDDGNMIGGLVGSNNESGGLSWISAESGSGAIPPPR
YWTPEEIKRILDLDEKPVRLVFSSMSNELEGWPDMDDPWMNQADDEQIEQ
FAEMLYRFKRPSSYSLQGLKHLLGVAWRKELSHTRSKAIRRSRQEFHLEL
LSLLRFSCPQSWIVSKLNASKGIFYKVLLDEPSDLVVPYAPGPRFMGKST
PPPKRFAFHALDMMILTGKRIGSRKSGSRDTPRKKRFQNFKRELKQMFKD
FVHGKNMDSRCKATATDPYGCHITADGIKVLGRNEIQTGVCELIDWEKWI
SKIIVYN


References
    Title: The genomes of four tapeworm species reveal adaptations to parasitism
    Tsai IJ, Zarowiecki M, Holroyd N, Garciarrubio A, Sanchez-Flores A, Brooks KL, Tracey A, Bobes RJ, Fragoso G and Berriman M <42 more author(s)>
    Ref: Nature, 496:57, 2013 : PubMed

            

    Title: The genome of the hydatid tapeworm Echinococcus granulosus
    Zheng H, Zhang W, Zhang L, Zhang Z, Li J, Lu G, Zhu Y, Wang Y, Huang Y and Wang S <21 more author(s)>
    Ref: Nat Genet, 45:1168, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer