Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lisin-LIN2214

Listeria innocua lin2214 protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Listeria innocua
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria innocua: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AL596171
1 UniProt : Q929R0
1 Interpro : Q929R0
1 Prodom : Q929R0
1 Pfam : Q929R0
1 PIRSF : Q929R0
1 SUPERFAM : Q929R0
Sequence
Graphical view for this peptide sequence: lisin-LIN2214
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPLFKHEGTYFNYEIQGEGIPFLFLHGLGDNLKFAFDTFNNDEKIQLISL
DQRGHGKSGHDSRKLSYDSLASDALALMDCLGIQRFYVGGLSMGAGVAVN
LAVHAANKVMGLILLRSSATDEPMKKQVIEWFNTVSIYLPKKNGSQLFEQ
DPLFPSIKDTYPKAIDTFKRYFEDDASVNYNKKFIDIPRDRPIKSKNELT
NVTMPTLILANNYDVIHPMEYSLFYARNIENAKYYELTPKTVDVEKHKLE
IDTYINTFILSNSKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLFKHEGTYFNYEIQGEGIPFLFLHGLGDNLKFAFDTFNNDEKIQLISL
DQRGHGKSGHDSRKLSYDSLASDALALMDCLGIQRFYVGGLSMGAGVAVN
LAVHAANKVMGLILLRSSATDEPMKKQVIEWFNTVSIYLPKKNGSQLFEQ
DPLFPSIKDTYPKAIDTFKRYFEDDASVNYNKKFIDIPRDRPIKSKNELT
NVTMPTLILANNYDVIHPMEYSLFYARNIENAKYYELTPKTVDVEKHKLE
IDTYINTFILSNSKK


Reference
    Title: Comparative genomics of Listeria species
    Glaser P, Frangeul L, Buchrieser C, Rusniok C, Amend A, Baquero F, Berche P, Bloecker H, Brandt P and Cossart P <45 more author(s)>
    Ref: Science, 294:849, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer