lismo-LMO0950

Listeria monocytogenes, hypothetical protein lmo0950

Comment

"Other strains: Listeria monocytogenes (strains F6900\; FSL N1-017\; J2818\; HPB2262\; FSL J1-194\; FSL N3-165\; FSL R2-503\; 1\/2a (F6854\; 08-5923\; 08-5578\; ATCC BAA-679 \/ EGD-e)\; 4b (H7858\; F2365\; CLIP80459))" || "Q721L6 (serotype 4b \/ strain F2365) Nelson et al"

Relationship

Family : Duf_915

Block : X

Position in NCBI Life Tree : Listeria monocytogenes

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKKVIILIIALAVIITGFWIIFLQFEPTKKEAKEPTVTAN
KTTTKEQNSV SEIAIPTLFVHGYSGTANSFGGMINRLAE
DGDVTKSLVMNVAADGTVSSK GDYDKFSHNPTIQVIFED
NKSSAANQTQWIQNVMKELKNNYHIEKVYAVG HSMGGVS
LTSYIEKVGNDKTYPVLEKLVLIGAPLNGLVIGDDGVTAY
DLT DSGPKKSSDRYSEFMKNKQKIPTNLHVLNIAGDTLN
GTKSDGSVSVASAL SGKFIFEGQAASYEEKTFTGKNAAH
SKLHENTNVDAEVADFLWGIEKVD

References

Title : Comparative genomics and transcriptomics of lineages I, II, and III strains of Listeria monocytogenes - Hain_2012_BMC.Genomics_13_144
Author(s) : Hain T , Ghai R , Billion A , Kuenne CT , Steinweg C , Izar B , Mohamed W , Mraheil MA , Domann E , Schaffrath S , Karst U , Goesmann A , Oehm S , Puhler A , Merkl R , Vorwerk S , Glaser P , Garrido P , Rusniok C , Buchrieser C , Goebel W , Chakraborty T
Ref : BMC Genomics , 13 :144 , 2012
Abstract : Hain_2012_BMC.Genomics_13_144
ESTHER : Hain_2012_BMC.Genomics_13_144
PubMedSearch : Hain_2012_BMC.Genomics_13_144
PubMedID: 22530965
Gene_locus related to this paper: lismo-LMO0110 , lismo-LMO0493 , lismo-LMO0580 , lismo-LMO0950 , lismo-LMO0951 , lismo-LMO1128 , lismo-LMO1258 , lismo-LMO2089 , lismo-LMO2433 , lismo-LMO2578 , lismo-LMO2755 , lismo-metx

Title : High-throughput genome sequencing of two Listeria monocytogenes clinical isolates during a large foodborne outbreak - Gilmour_2010_BMC.Genomics_11_120
Author(s) : Gilmour MW , Graham M , Van Domselaar G , Tyler S , Kent H , Trout-Yakel KM , Larios O , Allen V , Lee B , Nadon C
Ref : BMC Genomics , 11 :120 , 2010
Abstract : Gilmour_2010_BMC.Genomics_11_120
ESTHER : Gilmour_2010_BMC.Genomics_11_120
PubMedSearch : Gilmour_2010_BMC.Genomics_11_120
PubMedID: 20167121
Gene_locus related to this paper: lismo-LMO0110 , lismo-LMO0493 , lismo-LMO0580 , lismo-LMO0857 , lismo-LMO0950 , lismo-LMO0951 , lismo-LMO0977 , lismo-LMO1128 , lismo-LMO1258 , lismo-LMO1674 , lismo-LMO2089 , lismo-LMO2433 , lismo-LMO2450 , lismo-LMO2452 , lismo-LMO2578 , lismo-LMO2755 , lismo-metx

Title : Whole genome comparisons of serotype 4b and 1\/2a strains of the food-borne pathogen Listeria monocytogenes reveal new insights into the core genome components of this species - Nelson_2004_Nucleic.Acids.Res_32_2386
Author(s) : Nelson KE , Fouts DE , Mongodin EF , Ravel J , DeBoy RT , Kolonay JF , Rasko DA , Angiuoli SV , Gill SR , Paulsen IT , Peterson J , White O , Nelson WC , Nierman W , Beanan MJ , Brinkac LM , Daugherty SC , Dodson RJ , Durkin AS , Madupu R , Haft DH , Selengut J , Van Aken S , Khouri H , Fedorova N , Forberger H , Tran B , Kathariou S , Wonderling LD , Uhlich GA , Bayles DO , Luchansky JB , Fraser CM
Ref : Nucleic Acids Research , 32 :2386 , 2004
Abstract : Nelson_2004_Nucleic.Acids.Res_32_2386
ESTHER : Nelson_2004_Nucleic.Acids.Res_32_2386
PubMedSearch : Nelson_2004_Nucleic.Acids.Res_32_2386
PubMedID: 15115801
Gene_locus related to this paper: lismc-c1l0d9 , lismf-q71xq4 , lismo-LMO0110 , lismo-LMO0493 , lismo-LMO0580 , lismo-LMO0752 , lismo-LMO0760 , lismo-LMO0857 , lismo-LMO0950 , lismo-LMO0951 , lismo-LMO0977 , lismo-LMO1128 , lismo-LMO1258 , lismo-LMO1674 , lismo-LMO2089 , lismo-LMO2109 , lismo-LMO2433 , lismo-LMO2450 , lismo-LMO2452 , lismo-LMO2453 , lismo-LMO2578 , lismo-LMO2677 , lismo-LMO2755 , lismo-metx

Title : Comparative genomics of Listeria species - Glaser_2001_Science_294_849
Author(s) : Glaser P , Frangeul L , Buchrieser C , Rusniok C , Amend A , Baquero F , Berche P , Bloecker H , Brandt P , Chakraborty T , Charbit A , Chetouani F , Couve E , de Daruvar A , Dehoux P , Domann E , Dominguez-Bernal G , Duchaud E , Durant L , Dussurget O , Entian KD , Fsihi H , Portillo FG , Garrido P , Gautier L , Goebel W , Gomez-Lopez N , Hain T , Hauf J , Jackson D , Jones LM , Kaerst U , Kreft J , Kuhn M , Kunst F , Kurapkat G , Madueno E , Maitournam A , Vicente JM , Ng E , Nedjari H , Nordsiek G , Novella S , de Pablos B , Perez-Diaz JC , Purcell R , Remmel B , Rose M , Schlueter T , Simoes N , Tierrez A , Vazquez-Boland JA , Voss H , Wehland J , Cossart P
Ref : Science , 294 :849 , 2001
Abstract : Glaser_2001_Science_294_849
ESTHER : Glaser_2001_Science_294_849
PubMedSearch : Glaser_2001_Science_294_849
PubMedID: 11679669
Gene_locus related to this paper: lisin-LIN0589 , lisin-LIN0754 , lisin-LIN0850 , lisin-LIN0949 , lisin-LIN0950 , lisin-LIN0976 , lisin-LIN1094 , lisin-LIN1546 , lisin-LIN1782 , lisin-LIN2180 , lisin-LIN2214 , lisin-LIN2363 , lisin-LIN2527 , lisin-LIN2544 , lisin-LIN2547 , lisin-LIN2722 , lisin-LIN2825 , lisin-LIN2898 , lismc-c1l0d9 , lismo-LMO0110 , lismo-LMO0493 , lismo-LMO0580 , lismo-LMO0752 , lismo-LMO0760 , lismo-LMO0857 , lismo-LMO0950 , lismo-LMO0951 , lismo-LMO0977 , lismo-LMO1128 , lismo-LMO1258 , lismo-LMO1511 , lismo-LMO1674 , lismo-LMO2074 , lismo-LMO2089 , lismo-LMO2109 , lismo-LMO2262 , lismo-LMO2433 , lismo-LMO2450 , lismo-LMO2452 , lismo-LMO2453 , lismo-LMO2578 , lismo-LMO2677 , lismo-LMO2755 , lismo-metx