mycle-ML0370

 
Mycobacterium leprae hypothetical protein ml0370 b229_f1_20

Comment
Q49872 longer N-term


Relationship
Block L
Mycobacterium leprae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium leprae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AL583918, U00020
2 UniProtTrembl : Q9CCV6, Q49872
2 Interpro : Q9CCV6, Q49872
2 Prodom : Q9CCV6, Q49872
2 Pfam : Q9CCV6, Q49872
2 PIRSF : Q9CCV6, Q49872
2 SUPERFAM : Q9CCV6, Q49872
2 QuickSwissBlast : Q9CCV6, Q49872
 
Sequence
Graphical view for this peptide sequence: mycle-ML0370
Colored MSA for Chlorophyllase (raw)
MYGLQVTLTYRPIRLSGAIRNTDSICRSPISCYEPVRYRRQVAHTRKLLA
ALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPGVAFGHDWLTGTARYA
GLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGSALDIVAGVRLGPGNI
SVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAKSAVAIFPTVTSPAPE
QPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDDATLRIVSKAKAGGLV
EGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALGGDKEYRDFADPDMHL
PHTVPVDPEAPLVTPEQKIVTLLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYGLQVTLTYRPIRLSGAIRNTDSICRSPISCYEPVRYRRQVAHTRKLLA
ALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPGVAFGHDWLTGTARYA
GLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGSALDIVAGVRLGPGNI
SVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAKSAVAIFPTVTSPAPE
QPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDDATLRIVSKAKAGGLV
EGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALGGDKEYRDFADPDMHL
PHTVPVDPEAPLVTPEQKIVTLLK

no DNA




Reference
    Title: Massive gene decay in the leprosy bacillus
    Cole ST, Eiglmeier K, Parkhill J, James KD, Thomson NR, Wheeler PR, Honore N, Garnier T, Churcher C and Barrell BG <34 more author(s)>
    Ref: Nature, 409:1007, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer