psest-bpdF

 
Pseudomonas stutzeri, Pseudomonas putida, Pseudomonas resinovorans Pseudomonas sp., 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2, 4-dienoate hydrolase

Comment
Other strains: Pseudomonas stutzeri (Pseudomonas perfectomarina), Pseudomonas putida (Arthrobacter siderocapsulatus), Pseudomonas resinovorans Pseudomonas sp. XLDN4-9 . AB047548|13094180 meta-cleavage compound hydrolase [Pseudomonas sp. CA10] is completly identical to psest-bpdF Pseudomonas sp. XLDN4-9 carc . Pseudomonas resinovorans meta cleavage compound hydrolase Q8GI17 AB088420 completly identical to psest-bpdF


Relationship
Block X
Pseudomonas stutzeri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas stutzeri group: N E > Pseudomonas stutzeri subgroup: N E > Pseudomonas stutzeri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 2 more: AB001723, AB047548, AB088420
2 UniProt : Q4TTW0, B7XGF2
2 Ncbi-nid : 3293057, 13094152
2 Ncbi-pid : 3293062, 13094180
>3 UniProtTrembl links 1 more: O82821, Q9AQM4, Q4TTW0
>3 Interpro links 1 more: O82821, Q9AQM4, Q4TTW0
>3 Prodom links 1 more: O82821, Q9AQM4, Q4TTW0
>3 Pfam links 1 more: O82821, Q9AQM4, Q4TTW0
>3 PIRSF links 1 more: O82821, Q9AQM4, Q4TTW0
>3 SUPERFAM links 1 more: O82821, Q9AQM4, Q4TTW0
>3 QuickSwissBlast links 1 more: O82821, Q9AQM4, Q4TTW0
 
Sequence
Graphical view for this peptide sequence: psest-bpdF
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MLNKAEQISEKSESAYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAE
SEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIK
AMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDL
RPIINYDFTREGMVHLVKALTNDGYKIDDAMINSRYTYATDEATRKAYVA
TMQWIREQGGLFYDPEFIRKVPVPTLVVHGKDDKVVPVETAYKFLDLIDD
SWGYIIPHCGHWAMIEHPEDFANATLSFLSRRADITRAAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLNKAEQISEKSESAYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAE
SEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIK
AMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDL
RPIINYDFTREGMVHLVKALTNDGYKIDDAMINSRYTYATDEATRKAYVA
TMQWIREQGGLFYDPEFIRKVPVPTLVVHGKDDKVVPVETAYKFLDLIDD
SWGYIIPHCGHWAMIEHPEDFANATLSFLSRRADITRAAA

Graphical view for this nucleotide DNA sequence (903 bp): psest-bpdF



References
12 more
    Title: Genetic characterization and evolutionary implications of a car gene cluster in the carbazole degrader Pseudomonas sp. strain CA10
    Nojiri H, Sekiguchi H, Maeda K, Urata M, Nakai S, Yoshida T, Habe H, Omori T
    Ref: Journal of Bacteriology, 183:3663, 2001 : PubMed

            

    Title: Cloning and nucleotide sequence of carbazole catabolic genes from Pseudomonas stutzeri strain OM1, isolated from activated sludge
    Ouchiyama N, Miyachi S, Omori T
    Ref: J Gen Appl Microbiol, 44:57, 1998 : PubMed

            

    Title: Cloning of genes involved in carbazole degradation of Pseudomonas sp. strain CA10: nucleotide sequences of genes and characterization of meta-cleavage enzymes and hydrolase
    Sato SI, Ouchiyama N, Kimura T, Nojiri H, Yamane H, Omori T
    Ref: Journal of Bacteriology, 179:4841, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer