Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rat-estd

Rattus norvegicus (Rat) Esterase D

Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BC158790
1 UniProt : B0BNE5
1 UniProt : B0BNE5
1 Interpro : B0BNE5
1 Prodom : B0BNE5
1 Pfam : B0BNE5
1 PIRSF : B0BNE5
1 SUPERFAM : B0BNE5
Sequence
Graphical view for this peptide sequence: rat-estd
Colored MSA for A85-EsteraseD-FGH (raw)
MELKQISSNKCFGGLQKVFEHSSVELKCKMKFAIYLPPQAESAKCPALYW
LSGLTCTEQNFISKSGCQQAASEHGLVVIAPDTSPRGCNIKGEDDSWDFG
TGAGFFVNATEDPWNTNYRMYSYVTEELPQLINANFPVDPQRISIFGHSM
GGHGALICALKNPGKYRSVSAFAPICNPVLCPWGKKAFNGYLGPDQSKWK
AYDATCLVKSYSGPQIDILIDQGKDDEFLSNGQLLPDNFIAACTEKKIPV
VFRLQEGYDHSYYFIATFITDHIRHHAKYLNA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELKQISSNKCFGGLQKVFEHSSVELKCKMKFAIYLPPQAESAKCPALYW
LSGLTCTEQNFISKSGCQQAASEHGLVVIAPDTSPRGCNIKGEDDSWDFG
TGAGFFVNATEDPWNTNYRMYSYVTEELPQLINANFPVDPQRISIFGHSM
GGHGALICALKNPGKYRSVSAFAPICNPVLCPWGKKAFNGYLGPDQSKWK
AYDATCLVKSYSGPQIDILIDQGKDDEFLSNGQLLPDNFIAACTEKKIPV
VFRLQEGYDHSYYFIATFITDHIRHHAKYLNA


Reference
    Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)
    Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R and Malek J <104 more author(s)>
    Ref: Genome Res, 14:2121, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer