Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strco-MMYT

Streptomyces coelicolor putative thioesterase, mmyt

Comment
Other strains: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces coelicolor
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces albidoflavus group: N E > Streptomyces coelicolor: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AL590464, AJ276673
2 UniProt : Q9ACS2, Q9JN88
2 UniProt : Q9ACS2, Q9JN88
2 Interpro : Q9ACS2, Q9JN88
2 Prodom : Q9ACS2, Q9JN88
2 Pfam : Q9ACS2, Q9JN88
2 PIRSF : Q9ACS2, Q9JN88
2 SUPERFAM : Q9ACS2, Q9JN88
Sequence
Graphical view for this peptide sequence: strco-MMYT
Colored MSA for Thioesterase (raw)
MRLFCFHHAGGQGTAFLGWQKRLGARAEVIPVRLPPPEDVSAETADGSGM
SMTLVVASLDHELGPMLRRPFLFYGHSMGALVAYHLTRLRQSRGRPLPER
LLIGAYPAPHLPHRLAHCTHLPDEDLLALLPPHPAGHSRLLRQAPGLATA
TAARLRLHLGLCDSAAPAAPNPAQHTGHGSPQGRSEPLRCPVDVFTGISD
PLVTDAEAAAWRHHTRAGCRIHRIPGGHFFTRETPESRAAFFDRLCTVLA
GPSEWAAGASGPLPVTVAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLFCFHHAGGQGTAFLGWQKRLGARAEVIPVRLPPPEDVSAETADGSGM
SMTLVVASLDHELGPMLRRPFLFYGHSMGALVAYHLTRLRQSRGRPLPER
LLIGAYPAPHLPHRLAHCTHLPDEDLLALLPPHPAGHSRLLRQAPGLATA
TAARLRLHLGLCDSAAPAAPNPAQHTGHGSPQGRSEPLRCPVDVFTGISD
PLVTDAEAAAWRHHTRAGCRIHRIPGGHFFTRETPESRAAFFDRLCTVLA
GPSEWAAGASGPLPVTVAS


References
1 more
    Title: Cloning and physical mapping of the EcoRI fragments of the giant linear plasmid SCP1.
    Redenbach M, Ikeda K, Yamasaki M, Kinashi H
    Ref: Journal of Bacteriology, 180:2796, 1998 : PubMed

            

    Title: Nucleotide sequence analysis reveals similarities between proteins determining methylenomycin A resistance in Streptomyces and tetracycline resistance in eubacteria.
    Neal RJ, Chater KF
    Ref: Gene, 58:229, 1987 : PubMed

            

    Title: Resistance, regulatory and production genes for the antibiotic methylenomycin are clustered.
    Chater KF, Bruton CJ
    Ref: EMBO Journal, 4:1893, 1985 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer