Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strco-SCF43.16C

Streptomyces coelicolor, Streptomyces ambofaciens, Streptomyces lividans, putative prolyl aminopeptidase

Comment
Other strains: Streptomyces coelicolor (ATCC BAA-471 / A3(2) / M145), Streptomyces ambofaciens (ATCC 23877), Streptomyces lividans (TK24)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Streptomyces coelicolor
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces albidoflavus group: N E > Streptomyces coelicolor: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AL136502
>3 UniProt links 1 more: A0ADL4, D6EX25, Q9RD72
>3 UniProt links 1 more: Q9RD72, A0ADL4, D6EX25
>3 Interpro links 1 more: Q9RD72, A0ADL4, D6EX25
>3 Prodom links 1 more: Q9RD72, A0ADL4, D6EX25
>3 Pfam links 1 more: Q9RD72, A0ADL4, D6EX25
>3 PIRSF links 1 more: Q9RD72, A0ADL4, D6EX25
>3 SUPERFAM links 1 more: Q9RD72, A0ADL4, D6EX25
Sequence
Graphical view for this peptide sequence: strco-SCF43.16C
Colored MSA for Proline_iminopeptidase (raw)
MSVSYRQPGVVLTDRRFTVPLDHADPTGETIELYAREAVASDKADQDLPW
LVYLQGGPGGKADRFVGRPAWFGRALKEYRVLLLDQRGTGASTPASRQTL
PLRGGPAEQADYLAHFRADAIVRDCEAIRPQVTGGAPWTVLGQSFGGFCT
VAYLSLAPEGLSAALITGGLPSLDAHADDVYRAAYPRIERKVVAHYARYP
QDVERARRIADHLLTRDVVLPNGYRLTVEAFQSLGIMLGGGEGSHRLHFL
LEDAFVRTANGHELSDAFQEQAQGLLSYAGRPLYALVHEAIYGQDARPTD
WSAERVRAEFPRFDAAKALAGDEPLLFTGESIHPWMFDCDPALRPLRETA
ELLAARTDWTPLYDPARLAANEVPAAAAVYHDDMYVDTAHALTTARAIRG
LRTWVTDEFEHDGVRAGGPRVLDRLLALARDEA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVSYRQPGVVLTDRRFTVPLDHADPTGETIELYAREAVASDKADQDLPW
LVYLQGGPGGKADRFVGRPAWFGRALKEYRVLLLDQRGTGASTPASRQTL
PLRGGPAEQADYLAHFRADAIVRDCEAIRPQVTGGAPWTVLGQSFGGFCT
VAYLSLAPEGLSAALITGGLPSLDAHADDVYRAAYPRIERKVVAHYARYP
QDVERARRIADHLLTRDVVLPNGYRLTVEAFQSLGIMLGGGEGSHRLHFL
LEDAFVRTANGHELSDAFQEQAQGLLSYAGRPLYALVHEAIYGQDARPTD
WSAERVRAEFPRFDAAKALAGDEPLLFTGESIHPWMFDCDPALRPLRETA
ELLAARTDWTPLYDPARLAANEVPAAAAVYHDDMYVDTAHALTTARAIRG
LRTWVTDEFEHDGVRAGGPRVLDRLLALARDEA


References
    Title: Effect of salt on the activity of Streptomyces prolyl aminopeptidase
    Uraji M, Arima J, Uesugi Y, Iwabuchi M, Hatanaka T
    Ref: Biochimica & Biophysica Acta, 1774:1462, 2007 : PubMed

            

    Title: Complete genome sequence of the model actinomycete Streptomyces coelicolor A3(2)
    Bentley SD, Chater KF, Cerdeno-Tarraga AM, Challis GL, Thomson NR, James KD, Harris DE, Quail MA, Kieser H and Hopwood DA <33 more author(s)>
    Ref: Nature, 417:141, 2002 : PubMed

            

    Title: A set of ordered cosmids and a detailed genetic and physical map for the 8 Mb Streptomyces coelicolor A3(2) chromosome
    Redenbach M, Kieser HM, Denapaite D, Eichner A, Cullum J, Kinashi H, Hopwood DA
    Ref: Molecular Microbiology, 21:77, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer