Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tetur-ACHE

Tetranychus urticae (Two-spotted spider mite) tetur19g00850 CCE49 acetylcholinesterase

Comment
There is only one gene of AChE in Tetranychus urticae two-spotted spider mite. The strain TKD is the suceptible strain and the NCN is the resistant strain. AChE gene duplication results in the proportional overexpression which is necessary for the reduced catalytic activity caused by mutations G119S A280T F331W (G228S,A391T,F439W) UD strain is a suceptible strain with GAF G228A391F439, PyriF strain has 50% G228S mutation in two copies of AChE gene, AD strainshave 6 copies of AChE with mutation frequencies of 50% for G228S and 75% F439W. Other strains: Tetranychus kanzawai Kanzawa spider mite (only three aa different between ACHE in the two species Aiki et al. They show F439W mutation in resistant strain


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Tetranychus urticae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Chelicerata: N E > Arachnida: N E > Acari: N E > Acariformes: N E > Trombidiformes: N E > Prostigmata: N E > Eleutherengona: N E > Raphignathae: N E > Tetranychoidea: N E > Tetranychidae: N E > Tetranychus: N E > Tetranychus urticae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
11 mutations: Table (e.g. : A201S, A280T/F331W, A280T ... more)
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 54 more: AAO73450, AY188448, GQ461348
>3 UniProt links 30 more: Q86CZ4, D8V7K2, D8V7K7
1 Ncbi-nid : 30230331
1 Ncbi-pid : 30230332
>3 UniProt links 30 more: Q86CZ4, D8V7K2, D8V7K7
>3 Interpro links 30 more: Q86CZ4, D8V7K2, D8V7K7
>3 Prodom links 30 more: Q86CZ4, D8V7K2, D8V7K7
>3 Pfam links 30 more: Q86CZ4, D8V7K2, D8V7K7
>3 PIRSF links 30 more: Q86CZ4, D8V7K2, D8V7K7
>3 SUPERFAM links 30 more: Q86CZ4, D8V7K2, D8V7K7
Sequence
Graphical view for this peptide sequence: tetur-ACHE
Colored MSA for ACHE (raw)
MVPMFNHNINHFNNVIVTTLTHHQYTNSRCNSNNNVIKRITNSILKSVTV
FTVKTLWNHLLVPIVVILLFQSSANVFSSALPHSEINSFHADGPSSSSSF
NSEHHHHHHHNDPLVVLTKKGYVRGRSVVSPTGKPVDAFLGIRYAKPPTG
KFRFRHPKPIDSWQGIFNATSFSGACYQVNDTFFGNFMGATEWNPNVPLD
EDCLSVNIWVPRPRPKSAAVLLWIYGGGFWSGSSSLDFYDGSVLAGEESI
IFVSINYRVASLGFIFFDTSDAPGNAGLFDQLMAMEWIRENIAAFGGNPA
NITIFGESAGAVSAALHLLSPLSRNVFSQAILQSGSATCPWAISDRKKAY
QRSLALAQAVGCGSTSTRSVHAIIECMQSIPASELVAQEETTTGVVEFAF
IPIVDGSFLDEDPEVSLRTKNFKHTPILTGSNRDEGTYFLVYHSPHIFNL
SEGIYISRSEFQSLIRIIYPHLSPLAQEAVIQEYTHWINPDDQIENREAT
DKFVGDYHFTCPVNEMSYRYALYGNDVWTYHFTHRSSKSFWPSWMGVIHG
EEIKFVLGEPLDPVHGYTPAEVQLSKRIMRYWANFARTGNPNKQFPDGDD
TESIVWPEYTAHEKEYLVISTNDSSIGRGLRAKQCAFWKNFLPKLINALE
NRHNSTCTSHSNQIGSSNWSLAISLISLIMCFLPSLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVPMFNHNINHFNNVIVTTLTHHQYTNSRCNSNNNVIKRITNSILKSVTV
FTVKTLWNHLLVPIVVILLFQSSANVFSSALPHSEINSFHADGPSSSSSF
NSEHHHHHHHNDPLVVLTKKGYVRGRSVVSPTGKPVDAFLGIRYAKPPTG
KFRFRHPKPIDSWQGIFNATSFSGACYQVNDTFFGNFMGATEWNPNVPLD
EDCLSVNIWVPRPRPKSAAVLLWIYGGGFWSGSSSLDFYDGSVLAGEESI
IFVSINYRVASLGFIFFDTSDAPGNAGLFDQLMAMEWIRENIAAFGGNPA
NITIFGESAGAVSAALHLLSPLSRNVFSQAILQSGSATCPWAISDRKKAY
QRSLALAQAVGCGSTSTRSVHAIIECMQSIPASELVAQEETTTGVVEFAF
IPIVDGSFLDEDPEVSLRTKNFKHTPILTGSNRDEGTYFLVYHSPHIFNL
SEGIYISRSEFQSLIRIIYPHLSPLAQEAVIQEYTHWINPDDQIENREAT
DKFVGDYHFTCPVNEMSYRYALYGNDVWTYHFTHRSSKSFWPSWMGVIHG
EEIKFVLGEPLDPVHGYTPAEVQLSKRIMRYWANFARTGNPNKQFPDGDD
TESIVWPEYTAHEKEYLVISTNDSSIGRGLRAKQCAFWKNFLPKLINALE
NRHNSTCTSHSNQIGSSNWSLAISLISLIMCFLPSLR


References
7 more
    Title: Identification and characterization of striking multiple-insecticide resistance in a Tetranychus urticae field population from Greece
    Papapostolou KM, Riga M, Charamis J, Skoufa E, Souchlas V, Ilias A, Dermauw W, Ioannidis P, Van Leeuwen T, Vontas J
    Ref: Pest Manag Sci, 77:666, 2021 : PubMed

            

    Title: Acaricide resistance status and identification of resistance mutations in populations of the two-spotted spider mite Tetranychus urticae from Ethiopia
    Simma EA, Hailu B, Jonckheere W, Rogiers C, Duchateau L, Dermauw W, Van Leeuwen T
    Ref: Exp Appl Acarol, 82:475, 2020 : PubMed

            

    Title: The overexpression of acetylcholinesterase compensates for the reduced catalytic activity caused by resistance-conferring mutations in Tetranychus urticae
    Kwon DH, Choi JY, Je YH, Lee SH
    Ref: Insect Biochemistry & Molecular Biology, 42:212, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer