Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thecd-d1a9g5

Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081). Triacylglycerol lipase Tcur1278

Comment
Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081)


Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|Thermomonospora curvata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Thermomonosporaceae: N E > Thermomonospora: N E > Thermomonospora curvata: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





3 substrates: Polycaprolactone, Polyethylene-terephthalate, Polyurethane
No inhibitor
3 Genbank : CP001738, WP_012851645, ACY96861
1 UniProt : D1A9G5
1 UniProt : D1A9G5
1 Interpro : D1A9G5
1 Prodom : D1A9G5
1 Pfam : D1A9G5
1 PIRSF : D1A9G5
1 SUPERFAM : D1A9G5
Sequence
Graphical view for this peptide sequence: thecd-d1a9g5
Colored MSA for Polyesterase-lipase-cutinase (raw)
MSLRKSFGLLSATAALVAGLVAAPPAQAAANPYQRGPDPTESLLRAARGP
FAVSEQSVSRLSVSGFGGGRIYYPTTTSQGTFGAIAISPGFTASWSSLAW
LGPRLASHGFVVIGIETNTRLDQPDSRGRQLLAALDYLTQRSSVRNRVDA
SRLAVAGHSMGGGGTLEAAKSRTSLKAAIPIAPWNLDKTWPEVRTPTLII
GGELDSIAPVATHSIPFYNSLTNAREKAYLELNNASHFFPQFSNDTMAKF
MISWMKRFIDDDTRYDQFLCPPPRAIGDISDYRDTCPHT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLRKSFGLLSATAALVAGLVAAPPAQAAANPYQRGPDPTESLLRAARGP
FAVSEQSVSRLSVSGFGGGRIYYPTTTSQGTFGAIAISPGFTASWSSLAW
LGPRLASHGFVVIGIETNTRLDQPDSRGRQLLAALDYLTQRSSVRNRVDA
SRLAVAGHSMGGGGTLEAAKSRTSLKAAIPIAPWNLDKTWPEVRTPTLII
GGELDSIAPVATHSIPFYNSLTNAREKAYLELNNASHFFPQFSNDTMAKF
MISWMKRFIDDDTRYDQFLCPPPRAIGDISDYRDTCPHT


References
    Title: Degradation of Polyester Polyurethane by Bacterial Polyester Hydrolases
    Schmidt J, Wei R, Oeser T, Dedavid e Silva LA, Breite D, Schulze A, Zimmermann W
    Ref: Polymers (Basel), 9:65, 2017 : PubMed

            

    Title: Functional characterization and structural modeling of synthetic polyester-degrading hydrolases from Thermomonospora curvata
    Wei R, Oeser T, Then J, Kuhn N, Barth M, Schmidt J, Zimmermann W
    Ref: AMB Express, 4:44, 2014 : PubMed

            

    Title: Complete genome sequence of Thermomonospora curvata type strain (B9)
    Chertkov O, Sikorski J, Nolan M, Lapidus A, Lucas S, Del Rio TG, Tice H, Cheng JF, Goodwin L and Kyrpides NC <25 more author(s)>
    Ref: Stand Genomic Sci, 4:13, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer