Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thepa-q4n5m4

Theileria parva hypothetical protein

Comment
DUF900 275 521 only central part Pfam A DUF900 280 492


Relationship
Family|Duf_900
Block| X
Position in NCBI Life Tree|Theileria parva
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Piroplasmida: N E > Theileriidae: N E > Theileria: N E > Theileria parva: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AAGK01000002
1 UniProt : Q4N5M4
1 UniProt : Q4N5M4
1 Interpro : Q4N5M4
1 Pfam : Q4N5M4
1 PIRSF : Q4N5M4
1 SUPERFAM : Q4N5M4
Sequence
Graphical view for this peptide sequence: thepa-q4n5m4
Colored MSA for Duf_900 (raw)
IPEHVVLYIHGYNLTLYEACSQMAHIVSFSKLPPYVLPFVFNWQGHHWGA
FSAFAYPKAIKVCNNPNIVEAFIEVIEDLINLGIKHIHFLVHSCGTRVFL
NVIIAAIKKGYIVPVLSNEYLVINEEVRKERLRMDSIILINPDYPMEKFR
SYDYFVIRGYCDHIVMYVNNMDQCLYVSEFYNRERSLGRSIFEMCTSPKV
MSEMLKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IPEHVVLYIHGYNLTLYEACSQMAHIVSFSKLPPYVLPFVFNWQGHHWGA
FSAFAYPKAIKVCNNPNIVEAFIEVIEDLINLGIKHIHFLVHSCGTRVFL
NVIIAAIKKGYIVPVLSNEYLVINEEVRKERLRMDSIILINPDYPMEKFR
SYDYFVIRGYCDHIVMYVNNMDQCLYVSEFYNRERSLGRSIFEMCTSPKV
MSEMLKK


Reference
    Title: Genome sequence of Theileria parva, a bovine pathogen that transforms lymphocytes
    Gardner MJ, Bishop R, Shah T, de Villiers EP, Carlton JM, Hall N, Ren Q, Paulsen IT, Pain A and Nene V <34 more author(s)>
    Ref: Science, 309:134, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer